PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03473.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 216aa    MW: 24325.8 Da    PI: 9.996
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03473.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.4e-2884134252
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                                   pr+rWt eLH++F++a+e LGG++kAtPk il++m+ kgLt++hvkSHLQk
  Zpz_sc03473.1.g00040.1.am.mk  84 PRMRWTAELHRSFLQAIECLGGQDKATPKLILRFMGAKGLTISHVKSHLQK 134
                                   9*************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2680134IPR009057Homeodomain-like
PROSITE profilePS512949.07580140IPR017930Myb domain
SuperFamilySSF466891.2E-1581136IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2284134IPR006447Myb domain, plants
PfamPF002492.5E-785134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MRWLESLDQC IPFVPFHLFT SHASQYAKSC QEEEAGENRK ASVWFFPLAP AAFSAPGCLR  60
VQASEMGSGG RNGAVRRYNR SKEPRMRWTA ELHRSFLQAI ECLGGQDKAT PKLILRFMGA  120
KGLTISHVKS HLQKREVWTV WRRKRAEMGT EASYKGMQGS QGISEMRTAA NQYYCMHDYM  180
QAMAMEGRIK QEGLRWQRDA AAAAAADVVS SLQTVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1685134352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1685134352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1685134352Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1685134352Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1685134453Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03473.1.g00040.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126122e-50CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652650.19e-55PREDICTED: uncharacterized protein LOC102700890
TrEMBLJ3M0G92e-53J3M0G9_ORYBR; Uncharacterized protein
STRINGPavir.Gb01051.1.p2e-55(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.17e-26G2-like family protein