PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03370.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 704aa    MW: 75505 Da    PI: 7.6605
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03370.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.47.6e-29443496255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   +r+rWt eLH+rFv av++LGG++kAtPk++l++m+v gLtl+h+kS LQkYR+
  Zpz_sc03370.1.g00050.1.am.mk 443 QRVRWTRELHRRFVLAVSELGGADKATPKAVLRVMDVRGLTLHHLKSYLQKYRM 496
                                   7****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-14441499IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-28442500IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-21443496IPR006447Myb domain, plants
PfamPF002491.2E-5444495IPR001005SANT/Myb domain
PfamPF143798.3E-14558595IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MMLLPCRGRE REGPGPSSHG SPLPDRRIGI PHVGGRTTPA PRLPAFPDSL GPARTHTHAR  60
FPSFGNLLFA TALSLVALAL EYGKARNKTR GKEAGNVAEP SPALSLSQAL PAFHAESEAA  120
TIADGGGKKK GKRALAYTAA QAQGSDEHAK DADTTVSVRP SPREKRIVVT DRRSVGQVDE  180
WNGTVCVKRI EREAETRRYR DENDAGSCAC CDPGIGTSLD GHLASEAWPG IVVGDHTSSA  240
GPNTRACAPG VGQKLPLRSM PIATSGDGEG GSLASRAASD EWRSGLDSLI RLSPQKPGAV  300
CQLRQGAAAA GAGRPLRSPS LGVRGKRCGG ETLRLGTEGI RSKEEEGDEL ESKETNLLRA  360
QPVSNSQLAA YKTAPRHHRL PGTCSCCCRW SSLQLRPSRR ASHAGHAADA ATPRDVVLGT  420
LEMSSSGGCY AGQSGGEPAG RPQRVRWTRE LHRRFVLAVS ELGGADKATP KAVLRVMDVR  480
GLTLHHLKSY LQKYRMAVSR GLVEVTDDNG EGQNDRSSSS ENQPEEYDED TVTEMYRTFA  540
NDESEVLCDS SRSVTWIQRE VHRNLQEQIE VQRHLQLRIE AQGRYLHSVL RRAEEVLADY  600
SLDLPEAELS ELVSAAASTS SSLSLSPLHY PSTASCVTSS SSSEAESKAS AKRLCTCADM  660
RESTVEQSVQ SKRGVLQSHR QQQGDADEAE ADAENGSSGI DLNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-16444497356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16444497356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16444497356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16444497356Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03370.1.g00050.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.22e-36G2-like family protein