PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03365.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 336aa    MW: 33377.1 Da    PI: 8.0567
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03365.1.g00060.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57e-392583361
                        zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                   +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s
  Zpz_sc03365.1.g00060.1.am.mk 25 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRS 83
                                  57899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-312282IPR003851Zinc finger, Dof-type
PfamPF027011.5E-332782IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3852882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAGAGAATAV QQPSAGAPGG ADPRAEALRC PRCDSANTKF CYYNNYSLSQ PRHFCKACKR  60
YWTRGGTLRN VPVGGGCRKN KRSRTSAAGI GAAGRTVSSA SAAAAAGTSS SAASALSLPP  120
PAGGSSMQSL TSALGLSGGA SLASLLLGHG GGGSGADHLG LFHAAMQSVV SDTSAYEMQQ  180
QTQVDHLLGL GYGGGGAGAQ IQLKPWLQDA GAGAGGIMDT FYAPLLSRSI VPGLEELHVK  240
AEAAGAGEPQ QAKAAAAWEQ NSWELSTPSS TSNIVASDGL MAAAASTMNN PAVSSTASTA  300
TAAPSSFMYW ANDGIGGSAA SWPDLANCGS SIATLF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03365.1.g00060.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803596.11e-125dof zinc finger protein 2-like
TrEMBLA0A3L6T9P71e-127A0A3L6T9P7_PANMI; Dof zinc finger protein DOF5.1-like
STRINGTraes_2BS_C94BD2E9F.11e-119(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-37TARGET OF MONOPTEROS 6