PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03262.1.g00070.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 155aa    MW: 15925.8 Da    PI: 9.9702
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03262.1.g00070.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.32.9e-1711412656
                       G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRla 56
                                  +AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zpz_sc03262.1.g00070.1.sm.mk 11 VATPKQIRELMKVEGLTNDEVKSHLQKYRLH 41
                                  7****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015573.1E-141041IPR006447Myb domain, plants
SuperFamilySSF466893.17E-71144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-151144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MISCDATVRA VATPKQIREL MKVEGLTNDE VKSHLQKYRL HTRRPNSTVP TSSTSAATPA  60
PQVFVVGGIW VPPPEYAVAA AAAHPPVQQP TADASGGAST VYAPVATLPS GAQTQSRELG  120
AVKKQPNRFS DGRSAGDASS ASPAVSSSSS QTTSA
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc03262.1.g00070.1.sm.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954868.34e-38transcription factor NIGT1
SwissprotQ6Z8697e-31NIGT1_ORYSJ; Transcription factor NIGT1
TrEMBLA0A1E5UQ024e-44A0A1E5UQ02_9POAL; Myb family transcription factor EFM
STRINGSi019945m8e-39(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.14e-21G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]