PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02763.1.g00100.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 443aa    MW: 47663.3 Da    PI: 9.4242
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02763.1.g00100.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.46.8e-22362414153
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  ls
  Zpz_sc02763.1.g00100.1.am.mk 362 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRWVCLS 414
                                   6***********************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-22356412IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.384360437IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-20361414IPR004333Transcription factor, SBP-box
PfamPF031102.8E-16363414IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MTEELKERCV LFLTPEVRSL SLSVPLGGEV AAPSSEERCA VLGVSCICRN PSSSPPLLVF  60
SDLFFVPPAL HIFQRRLSPA LLPARIISPR ERERGPCWIC RVAADGERPA LFRRCRRAAD  120
ERQCTHGRTV RVSAVASSSA RPIPSTTAAI DRSGDSSPVA RVASWLGSAP SSNDSSLHGD  180
AVAAAGRGRG RPHPPTTFLM TLGLLCAPGE LFLLGRRGSC DRPGGFRKSR SHQCQLHGCT  240
HGAFHQSQKL IFNNGRKTTP LPHHFFVISI TQQKDGALRT AHCSSLRSPN QPRIAQAESA  300
MEWTVPKPAA SPSSPPLLWD WGDSAAPASG SSGEAPARRG GKEREGKRAK GGEDGGGGGE  360
VRCQVEGCGL DLGGAKEYHR KHRVCEAHTK CPRVVVAGQE RRFCQQCSRW VCLSCCFQFP  420
GRRSSAVDLV DPCRAANSRL SCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-13358410153squamosa promoter-binding protein-like 12
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02763.1.g00100.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626514e-49AK062651.1 Oryza sativa Japonica Group cDNA clone:001-105-E07, full insert sequence.
GenBankAP0057724e-49AP005772.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0073A21.
GenBankAP0149584e-49AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126104e-49CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4875223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.35e-21squamosa promoter binding protein-like 2