PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02747.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 455aa    MW: 49134.8 Da    PI: 6.0041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02747.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.22e-29203256255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWt eLH+rFv av++LGG++kAtPk++l++m v gLtl+hvkS LQkYR+
  Zpz_sc02747.1.g00010.1.am.mk 203 PRLRWTRELHARFVLAVSELGGADKATPKAVLRVMAVRGLTLHHVKSYLQKYRT 256
                                   8****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-28201259IPR009057Homeodomain-like
SuperFamilySSF466898.6E-15201258IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-22203256IPR006447Myb domain, plants
PfamPF002495.6E-6204255IPR001005SANT/Myb domain
PfamPF143799.1E-15309346IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MCDASYLHLK ASLGARGDVV AASGGGAARI RSKEEEGEEC EGTARQQGRP ASVTLPTAER  60
FAPFRGQRSE SKRSNQLRMR KKMHGILAWP RGPRLPRHPY SLPSSPPGRR VVYMRTYIPQ  120
ATGSTEEEYI RAVESKENQP AQCSASDSGS APPAAAASHA GGHATDAATP RDVDFDTLEM  180
SSSGGGGVYA GQSGGEAAAG RSPRLRWTRE LHARFVLAVS ELGGADKATP KAVLRVMAVR  240
GLTLHHVKSY LQKYRTAVSS GLGTVTADNG EGQNDWSSSS ENEYNEEDRA FAGDEGEALC  300
DSSRSVVWMQ REVQRNLQDQ IEVQRRLQLR IEAQGRYLES LLRRAYDVPA DHSLGSPAEA  360
AETEHSEITS PAVSTSSSSL SSSPPRHGST DSCVTSSSSS EAESKTWRRY TCADARECTV  420
NQPVQSKRDV LQGDAEEAEE DADTENGSSE FDLNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-18204257457Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02747.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973515.12e-73myb family transcription factor PHL8
TrEMBLA0A0A9EY775e-81A0A0A9EY77_ARUDO; Uncharacterized protein
STRINGORGLA08G0138500.13e-73(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-35G2-like family protein