PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02674.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 624aa    MW: 70249.7 Da    PI: 5.0903
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02674.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS249.31.5e-762385693332
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lL++cA+av++++++ a +lL+++++ as +g+++qRla +f+++L+arla+++++l +    ++ s   ++e l a++l
  Zpz_sc02674.1.g00090.1.am.mk 238 TLLTHCAQAVAANNHASAWQLLNQIKQDASTTGNATQRLARCFAKGLEARLAGTGTQLWQFRMGEPPS---TVEYLEAYQL 315
                                   68***************************************************999999766666665...99******** PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQ..WpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   ++ v+ + k++     ++I++ + g+++vHi+D+++ + +Q  W+ Ll+ La+R++g+p+++iT++++p +    +e++ee
  Zpz_sc02674.1.g00090.1.am.mk 316 YVSVCSFDKVALCFSVKTIVDTIVGKSKVHIVDYGLDYAFQlrWADLLELLANREGGSPEVKITAINHPGHWfyPEEQMEE 396
                                   ***********************************99998888*************************99889******** PP

                          GRAS 161 tgerLakfAeelgvp.fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkv 238
                                   tg+rL+k A+elg++ f+f++ + k++ed+ +++L+++++E+l+Vn +++l +l+desv  ++  +rd+vL+ + +++P v
  Zpz_sc02674.1.g00090.1.am.mk 397 TGSRLHKWAAELGLRyFKFHT-IRKKWEDVCIQDLDTESNEVLIVNDHFNLSTLMDESVFFDDpcPRDAVLSNIAKMRPAV 476
                                   **************77*****.7************************************9999999*************** PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                                   v+    ++ + ++sFl rf  al yy+alfd+l+a++pres++r+++E+el+g  +vn++a eg + ++  e++ +W++r 
  Zpz_sc02674.1.g00090.1.am.mk 477 VIQNVVNCTY-GTSFLSRFRGALFYYMALFDMLDATIPRESKQRVVLEQELFGGYAVNAIASEGVNVVQHPEKYTQWQARN 556
                                   **99999999.679******************************************************************* PP

                          GRAS 320 eeaGFkpvplsek 332
                                   ++aG  p+ ++++
  Zpz_sc02674.1.g00090.1.am.mk 557 QRAGIDPLGFTTT 569
                                   ******9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.159210591IPR005202Transcription factor GRAS
PfamPF035145.1E-74238569IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MTPTPEEFFV HCLMEQSPPS PSLCPDLPPL PDAYGEGWLF PNEMMLPHIS RMLMEDDTEE  60
KLSDDPALLR VQQPFAEILF DPSFGTDMGN TEGPMDLMQD GSCYQMTAES AFAKGADAVG  120
AFLRGMEEAK TFLPKYGCFR EDDLVSQLFR ESTNHGGPRT NNSKDEAAVS MTDEPMTMTK  180
EQAERDDASE MLDRMMLQGC EKFVRDMEKL RITMANEAEE DRRKDRSNTA RVVVDLPTLL  240
THCAQAVAAN NHASAWQLLN QIKQDASTTG NATQRLARCF AKGLEARLAG TGTQLWQFRM  300
GEPPSTVEYL EAYQLYVSVC SFDKVALCFS VKTIVDTIVG KSKVHIVDYG LDYAFQLRWA  360
DLLELLANRE GGSPEVKITA INHPGHWFYP EEQMEETGSR LHKWAAELGL RYFKFHTIRK  420
KWEDVCIQDL DTESNEVLIV NDHFNLSTLM DESVFFDDPC PRDAVLSNIA KMRPAVVIQN  480
VVNCTYGTSF LSRFRGALFY YMALFDMLDA TIPRESKQRV VLEQELFGGY AVNAIASEGV  540
NVVQHPEKYT QWQARNQRAG IDPLGFTTTK FTLEFVLHAH RSSRHPAVAH RPHHHAAPAV  600
AHRLLQPCGP CRCSPPATTL QPLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-272405648326GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.14e-80GRAS family protein