PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02595.1.g00060.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LFY
Protein Properties Length: 133aa    MW: 14980.3 Da    PI: 9.89
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02595.1.g00060.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY239.81.3e-7317123280386
                       FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfn 360
                                   +vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k+rgenvGawrqacy+plv+iaar+g+didavf+
  Zpz_sc02595.1.g00060.1.sm.mk  17 QVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKARGENVGAWRQACYAPLVEIAARHGFDIDAVFA 97 
                                   7******************************************************************************** PP

                       FLO_LFY 361 ahprLsiWYvPtkLrqLChlerskas 386
                                   ahprLsiWYvPt+LrqLCh++r+ ++
  Zpz_sc02595.1.g00060.1.sm.mk  98 AHPRLSIWYVPTRLRQLCHQARNGHA 123
                                   **********************9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-7416123IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MAGENRTAVT LFVLVAQVTN QVFRYAKKCG ASYINKPKMR HYVHCYALHC LDEEASNALR  60
RAYKARGENV GAWRQACYAP LVEIAARHGF DIDAVFAAHP RLSIWYVPTR LRQLCHQARN  120
GHATAGLPPP PMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-641612057161PROTEIN LEAFY
2vy2_A1e-641612057161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02595.1.g00060.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1849571e-148KF184957.1 Saccharum hybrid cultivar R570 clone BAC 011C13 sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826267.12e-77probable transcription factor FL
SwissprotA2XX391e-69FL_ORYSI; Probable transcription factor FL
SwissprotQ0JAI11e-69FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A1E5W6A34e-78A0A1E5W6A3_9POAL; Putative transcription factor FL
STRINGPavir.Gb00795.1.p1e-77(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-68floral meristem identity control protein LEAFY (LFY)