PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LFY
Protein Properties Length: 313aa    MW: 33589 Da    PI: 6.7299
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                       FLO_LFY   1 mdpea.fsas.lfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvs 76 
                                   mdp++ fsa+  f+wd   p   a+a+p+   +    ++++l    a  a++ releel+ +yGvr +tva+i elGft+s   1 MDPNDaFSAAhPFRWDlgpP---AHAAPHPPPPPPPPPPPSLPFPLAPPANAPRELEELVAGYGVRPSTVARILELGFTAS 78 
                                   777654876659****6632...333333333333333344456677788889**************************** PP

                       FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqee 157
                                   tL++m+++eldd+m++l+ +fr+d+l+Ger+G++aa+raer r+ +      r      ++  +lda+sqe+ls+e++  79 TLLGMTERELDDMMAALAGLFRWDVLLGERFGLRAALRAERARVVALG---GRF-----QTGGTLDAASQEVLSDERDVA- 150
                                   ********************************************9955...444.....46779***********98855. PP

                       FLO_LFY 158 keaagsggeglgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse.......ededeeeeededeegsgedgeerqre 230
                                       +sgg    e +   a+ +k+ +++  ++k  k++rkk+ +           e ++++   ++++e+s+ +g erqre 151 ----ASGGVADDEIGRRLAAGRKQAKKEAATRKGkKARRKKELRP--LdvlevenEGDEDDGGASDSTESSAGGGGERQRE 225
                                   ....44444444444433333222222222222212222222221..12334443334444444555556677788***** PP

                       FLO_LFY 231 hPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                                   hPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptk 226 HPFVVTEPGEVARAKKNGLDYLFHLYEQCRIFLLQVQTIAKMGGHKSPTK 275
                                   *************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.2E-1021275IPR002910Floricaula/leafy protein
SuperFamilySSF1014477.59E-62737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A3e-26219275258PROTEIN LEAFY
2vy2_A3e-26219275258PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.11e-128probable transcription factor FL
SwissprotQ0JAI11e-113FL_ORYSJ; Probable transcription factor FL
TrEMBLK3YC121e-127K3YC12_SETIT; Uncharacterized protein
STRINGSi011756m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.18e-26floral meristem identity control protein LEAFY (LFY)