PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02488.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 576aa    MW: 62065.1 Da    PI: 8.5968
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02488.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.68.8e-433964951100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C++ Cvlapyfp ++p+kfa +h++FGasn++kll++lpee+r da+ss+vyeA ar+rdPvyG++g i+
  Zpz_sc02488.1.g00020.1.am.mk 396 PCAACKILRRRCVDRCVLAPYFPPTDPRKFATAHRVFGASNIIKLLQELPEEHRADAVSSMVYEASARIRDPVYGCAGAIW 476
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq+q++ lka+la++++e
  Zpz_sc02488.1.g00020.1.am.mk 477 QLQKQVNDLKAQLARAHAE 495
                                   **************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.728395496IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-42396493IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MIVRCKPPVK VKPKRVDRAG GASAAGERGD SEVGDSGGCV TESETAGADQ GHGGGPHWQR  60
RLGPTLARAA ERELNPRSPA DKSQETARLD LSFVLREEWR GDSGERSILT MELERPLTRR  120
TPAARPEDCR RLVGHVSRMR GTLMPNWTDP VGRLITGKDP ADRHQRPAIG GSRDDDPSNR  180
AELNMATGSP ESDHEGQTAR ANSVYWSSWR DGPVLEGACG ICSPDDGKCV PDMLQEAVPD  240
ALQDQHRQPV STPAARRSSR ARIRSSRISG EEWALILLLR FLLALALFFT SSRSARENSS  300
SIICFRVRAE PNQPIGGVRT KQQWRRHAAR HRGPPPSALQ VKSKAQQATH MDLVSHAPTT  360
MDESSACTMV ATPPPQHGPS TPPASPQPAA AVVLSPCAAC KILRRRCVDR CVLAPYFPPT  420
DPRKFATAHR VFGASNIIKL LQELPEEHRA DAVSSMVYEA SARIRDPVYG CAGAIWQLQK  480
QVNDLKAQLA RAHAEFAVTR AQHAHLLALV CMEVAAASSS PAPYCAVDYS SHLAAAVAPA  540
AAQAAADALY VVDGAGAGGL QLHASAVSWG DESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4039549610111LOB family transfactor Ramosa2.1
5ly0_B7e-4039549610111LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02488.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0790212e-70AC079021.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0008A07, complete sequence.
GenBankAC0930892e-70AC093089.1 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1729_E02, complete sequence.
GenBankAP0149612e-70AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126132e-70CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-55LOB domain-containing protein 1