PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02481.1.g00110.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 229aa    MW: 23838.9 Da    PI: 9.8371
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02481.1.g00110.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC811.1e-25135179145
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  Zpz_sc02481.1.g00110.1.sm.mk 135 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 179
                                   69****************************************985 PP

2QLQ51.53.1e-1869105137
                           QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  Zpz_sc02481.1.g00110.1.sm.mk  69 SALTFMQQQELEHQVLIYRYFAAGAPVPVQLVLPIWK 105
                                   799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.8E-569105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.02670105IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-1070104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.701135179IPR014977WRC domain
PfamPF088793.3E-21136178IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MADDKETTDS AQPPSKLPRL SSAADSNAGT VTMAASSPLV LGLGLGLGGD GGGVERDAEA  60
ASTTSKARSA LTFMQQQELE HQVLIYRYFA AGAPVPVQLV LPIWKSVAAS SFGPQRFPSL  120
MGLGSLCFDY RNSMEPEPGR CRRTDGKKWR CSRDVVPGHK YCERHVHRGR GRSRKPVEAA  180
AAASAGAPAH NAPPAAVHHH GHAGASPAAA GLGFSPTSVL LAHSAARAT
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02481.1.g00110.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278571e-161KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816416.11e-105growth-regulating factor 10-like isoform X2
SwissprotQ6EPP94e-97GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A2S3GSC01e-104A0A2S3GSC0_9POAL; Uncharacterized protein
STRINGSi018252m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.11e-37growth-regulating factor 3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]