PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02471.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 704aa    MW: 73561.7 Da    PI: 9.4636
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02471.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.55.1e-933367032373
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaa 80 
                                   ++lL ++A av++g+++ a a La l+  a+p+gd+ qRl+a++t AL++r+           p+s+    +    e+ aa
  Zpz_sc02471.1.g00090.1.am.mk 336 RQLLSDAAAAVADGNQTVAAAHLAVLKISANPRGDAEQRLVAMMTGALSSRVGP---------PSSQHLV-DlcGGEQRAA 406
                                   6899*************************************************9.........2222222.2236667789 PP

                          GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........ 153
                                    +l+++vsP++ ++   aN aIl+av+ ++++H++Dfdis  +Q +aL+qaL +R++   sl+iT+v++p+s         
  Zpz_sc02471.1.g00090.1.am.mk 407 CQLLHDVSPCFGLALHGANLAILDAVADHRAIHVVDFDISI-AQHIALIQALGNRRAAGTSLKITAVADPTSPftspftpa 486
                                   9**************************************97.79*************************998889999999 PP

                          GRAS 154 skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksl 234
                                    +++l +t erL++ A++ gv+f+f++ v+ + +++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+sl
  Zpz_sc02471.1.g00090.1.am.mk 487 LAQALASTTERLKRHAQQAGVEFRFKA-VSCSAAEIEASRLGCQPGEALAVNLAFILSRVPDESVSPANPRDELLRRVRSL 566
                                   999************************.6889999********************************************** PP

                          GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                                    P+vv++veqe+++n++++++rf++a+ +y a+++sl+a+l r+s +r+  E++ l+ +++n+va ega+r+er+e ++kW
  Zpz_sc02471.1.g00090.1.am.mk 567 GPRVVTLVEQELNTNTAPLAARFADACAHYGAVLESLDATLCRDSAQRARAEAA-LASKVCNAVAREGADRVERCEVFGKW 646
                                   *****************************************************9.9************************* PP

                          GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   r+r+++aG++pv++++ +a+ +k+ l      g+ v+ ++g l  gW++r ++++SaW
  Zpz_sc02471.1.g00090.1.am.mk 647 RARFGMAGLRPVAIGQGVADRVKARLGPAR-PGFDVKLDNGRLGVGWMGRVVTVASAW 703
                                   ***************************999.9************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.847309685IPR005202Transcription factor GRAS
PfamPF035141.8E-90336703IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MLSSPAPIPP IGQILPAAVV ALRRQRHCCR TGVLASDPKQ SQERAIRPTL LSFSSRSTLL  60
FVPPPLSAAS APGFSGMEPA GWCDPRRRAY GYGYGVGSAV DAPPMIRQQQ HPPAAPRPDA  120
AAGATGSVLK RSLSEMERWQ QALCLRAVKQ RTAAPVPPGH HQLDIGAVLA GAASARARGL  180
SGQPSAGFAW PSPQPSSTLS SLTTASPMQP LWQRQVMAAP SAPVAKGAAA TARPTTAREM  240
VLLRELEKQL LGDDEEVEAE AAGSVCGSAV TNSGWGETIH ELNSIAATPL PSHPKTMTAT  300
NRYNTVPMSR SPSNSTSSAT SSTASSSPPT SAASSRQLLS DAAAAVADGN QTVAAAHLAV  360
LKISANPRGD AEQRLVAMMT GALSSRVGPP SSQHLVDLCG GEQRAACQLL HDVSPCFGLA  420
LHGANLAILD AVADHRAIHV VDFDISIAQH IALIQALGNR RAAGTSLKIT AVADPTSPFT  480
SPFTPALAQA LASTTERLKR HAQQAGVEFR FKAVSCSAAE IEASRLGCQP GEALAVNLAF  540
ILSRVPDESV SPANPRDELL RRVRSLGPRV VTLVEQELNT NTAPLAARFA DACAHYGAVL  600
ESLDATLCRD SAQRARAEAA LASKVCNAVA REGADRVERC EVFGKWRARF GMAGLRPVAI  660
GQGVADRVKA RLGPARPGFD VKLDNGRLGV GWMGRVVTVA SAWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-393317031374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0A9FCJ70.0A0A0A9FCJ7_ARUDO; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-88SCARECROW-like 8