PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02258.1.g00040.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 102aa    MW: 10696.2 Da    PI: 12.4282
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02258.1.g00040.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP49.91.2e-154403773
                           TCP 37 deLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                                  +eLG+++d++tieWLl+qa+p+i+ +tgt++++as +
  Zpz_sc02258.1.g00040.1.sm.mk  4 RELGHKSDGQTIEWLLRQAEPSIIVATGTGTTPASVS 40
                                  89***************************99999555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.739129IPR017887Transcription factor TCP subgroup
PfamPF036347.6E-11446IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MTPRELGHKS DGQTIEWLLR QAEPSIIVAT GTGTTPASVS TSSFSPTAVD GMPIIAAPMT  60
TPKLHPSLRR ASGRFRRGLT PLASSGASGP RLTSPSRTRR GT
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02258.1.g00040.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018436782.12e-17PREDICTED: transcription factor TCP7-like
TrEMBLA0A2U1L6V66e-16A0A2U1L6V6_ARTAN; Transcription factor, TCP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP194133100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.13e-20TCP family protein