PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02201.1.g00050.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 352aa    MW: 37058.8 Da    PI: 9.665
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02201.1.g00050.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-383393262
                        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGG+lrn+P+Ggg+r+nk+s+
  Zpz_sc02201.1.g00050.1.sm.mk 33 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGTLRNIPIGGGCRRNKRSR 93
                                  67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-323591IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253786IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3293791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MTAVAAGDEL LKGGTSGGGG TTTPRQQQPP PPPEQGLRCP RCDSPNTKFC YYNNYSLSQP  60
RHFCKTCRRY WTKGGTLRNI PIGGGCRRNK RSRSTTSRVS LNLRGVTVNA SIDQQQSSAR  120
LGRFLGGGGA MVMSSPIGGV TSADYQPGAA AGSMPPPRLN IPAVGQYVPF VEWSSGPTAV  180
DLTGGGGNSS AAAAMRSTIA SFIESQSFIN QDLHWKLQQQ RLSTVSLAQP TSSAAGHTAP  240
RRVGAGAFMQ ISAGAPVMEP MPTVTSWIMD SSCVFLSPPQ PANTTSAVMA TTTPNCNINS  300
GLSSGDHATF NNSCDVGTIP TWGNIVVDVY NATFPLNWYK DVIARLGVGM TF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02201.1.g00050.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475241e-67EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269771e-67KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796800.13e-77dof zinc finger protein DOF5.7-like
TrEMBLA0A3L6SBJ54e-77A0A3L6SBJ5_PANMI; Dof zinc finger protein DOF5.7-like
STRINGSi036311m1e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-30DOF zinc finger protein 1