PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02013.1.g00150.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 212aa    MW: 22527.9 Da    PI: 6.7457
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02013.1.g00150.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.52.2e-3650109261
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     k+++l+cprC stntkfCyynnys++qPr+fC+aCrryWt+GG+lr+vPvGg++r+ k++
  Zpz_sc02013.1.g00150.1.sm.mkhc  50 KQQQLECPRCRSTNTKFCYYNNYSTAQPRHFCRACRRYWTHGGTLRDVPVGGATRRAKRR 109
                                     6899***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-3252108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2354108IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-2554105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAPAASILAA TSAASSKRPA DSVDADHLLA AESSSALTQG DAEAARGKNK QQQLECPRCR  60
STNTKFCYYN NYSTAQPRHF CRACRRYWTH GGTLRDVPVG GATRRAKRRR VSDSTELSSS  120
PPQTTTALVS EDTCPPDLSS TAFPFLSDGS YLPQFDLGLF GPAALSSWSS VLPDFYEGIA  180
PTWDNGTVGA AGVTGAWGDV TGLDFSWPPP GN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106110KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc02013.1.g00150.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0398417e-68BT039841.1 Zea mays full-length cDNA clone ZM_BFc0046N05 mRNA, complete cds.
GenBankJX4284537e-68JX428453.1 Zea mays subsp. mays clone pUT3047 DOF41 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824347.11e-76dof zinc finger protein DOF1.6-like
TrEMBLA0A1E5VN136e-88A0A1E5VN13_9POAL; Uncharacterized protein
STRINGSb06g033010.19e-74(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.19e-34Dof family protein