PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01933.1.g00030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 175aa    MW: 19239.7 Da    PI: 8.2249
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01933.1.g00030.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.52.3e-261867251
                       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                                  pr+rWt+ LH++Fveave LGG+++AtPk+il+lm+v+g++++h+kSHLQ
  Zpz_sc01933.1.g00030.1.sm.mk 18 PRMRWTEVLHRQFVEAVECLGGKDEATPKRILQLMSVDGVSISHIKSHLQ 67
                                  8************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-241467IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-211867IPR006447Myb domain, plants
SuperFamilySSF466891.67E-131867IPR009057Homeodomain-like
PfamPF002491.1E-51967IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MRYFERKGVR QYNRSEVPRM RWTEVLHRQF VEAVECLGGK DEATPKRILQ LMSVDGVSIS  60
HIKSHLQYPS GKQLPQVDIN RSEQQRAIRP SNNSFSKKPA EKQKGCDLTL SIGMWPEDAN  120
SDADGSSTIS EELAAPPAGA EPFGSPAAGG RFAAVKQESA PALNLDLTIS SSWLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-151967452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01933.1.g00030.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810426.14e-37probable transcription factor KAN3
TrEMBLT1MM387e-47T1MM38_TRIUA; Uncharacterized protein
STRINGTRIUR3_18893-P11e-47(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.18e-23G2-like family protein