PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01826.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 300aa    MW: 32007.4 Da    PI: 8.3746
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01826.1.g00070.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.42.8e-39441431100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC+++Cv+apyfp ++p+kfa vh++FGasnv+k+l+++p+  r da++sl+yeA+ar+rdPvyG+v+ il
  Zpz_sc01826.1.g00070.1.am.mk  44 PCAACKMLRRKCTQGCVFAPYFPPDDPAKFARVHQVFGASNVSKILNNVPQPLRGDAANSLAYEADARIRDPVYGCVAYIL 124
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    l+ ++e+ +a+++++++e
  Zpz_sc01826.1.g00070.1.am.mk 125 ILECKVEEIRADIVAARKE 143
                                   *************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.83143144IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-3944141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
LFPIPTTLTV PGPEHIAAQH RSERPAPIRA ATPKGRSMSS PSSPCAACKM LRRKCTQGCV  60
FAPYFPPDDP AKFARVHQVF GASNVSKILN NVPQPLRGDA ANSLAYEADA RIRDPVYGCV  120
AYILILECKV EEIRADIVAA RKELAVYIGP AAFGPLAAAP RYHHPAAAQY AGVHPHHLDQ  180
QMMRHRQQKM AEARRRAATV DVVTVQGVMM GQATFYAHAE QGSSLVGPMV AAVPHDAGAP  240
YDGGFVLQPQ PASQARTAVA LPLTYQMESP PPSSSGNSPP EVVLRQQHTD GSDEGSGGDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-404314710114LOB family transfactor Ramosa2.1
5ly0_B4e-404314710114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01826.1.g00070.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025794967.12e-76protein ASYMMETRIC LEAVES 2-like
TrEMBLA0A1E5VYJ42e-80A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m2e-75(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-40ASYMMETRIC LEAVES 2-like 1