PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01756.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 364aa    MW: 39489.1 Da    PI: 8.8322
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01756.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP161.83.5e-501162711136
                           TCP   1 aagkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                                   aa +kdrhski+T++g+RdRR+Rls ++a++fF+Lqd+LGfdk+skt++WLl+ +k+ai+e++ +  +++sec ++sss s
  Zpz_sc01756.1.g00020.1.am.mk 116 AASRKDRHSKICTAGGMRDRRMRLSFDIARKFFALQDMLGFDKASKTVQWLLNTSKAAIQEIMTD--DASSECVDGSSSLS 194
                                   588**************************************************************..66666966666666 PP

                           TCP  82 as...nsssg......................kaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                                   ++   n                          ka+++++++k+++ksa+++  l+ke+rakar+rarertrek+r+++++
  Zpz_sc01756.1.g00020.1.am.mk 195 VDgkhN---LteelggdqqkkgngcsegkksaKARRETTTPKPPRKSANAHPVLDKETRAKARERARERTREKHRMRWVK 271
                                   663330...235566666667789999999978888888**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-44118267IPR005333Transcription factor, TCP
PROSITE profilePS5136934.558119177IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.54247264IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MFPFCDSPSH KPHVHGDMPL YQQLQLSSPS PKPDQSSSSF YYYPCSPPFA AAADASSFDM  60
SYQLDSAAAT TPAPAVVNSP ELPMRPSMEQ QPARKHGPGN AQGAGGASLD TASPAAASRK  120
DRHSKICTAG GMRDRRMRLS FDIARKFFAL QDMLGFDKAS KTVQWLLNTS KAAIQEIMTD  180
DASSECVDGS SSLSVDGKHN LTEELGGDQQ KKGNGCSEGK KSAKARRETT TPKPPRKSAN  240
AHPVLDKETR AKARERARER TREKHRMRWV KLASAIDVEA AAGRDQPNAS NLNHSPSMNM  300
ASAAELGERC SSTLNHGGRT QEVSMPSEPN DMILAFGNGA YGGRNYCQEQ WELGGVVFAN  360
SRFY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in apical dominance. Represses the growth of axillary organs (e.g. lateral branches), but enables the formation of female inflorescences. Regulates the number and length of axillary branches. {ECO:0000269|PubMed:12524360, ECO:0000269|PubMed:16642024, ECO:0000269|PubMed:17947410, ECO:0000269|PubMed:8536981, ECO:0000269|PubMed:9087405}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01756.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982035.11e-153transcription factor TEOSINTE BRANCHED 1
RefseqXP_025796975.11e-153transcription factor TEOSINTE BRANCHED 1-like
SwissprotQ93WI21e-133TB1_MAIZE; Transcription factor TEOSINTE BRANCHED 1
TrEMBLA0A346M1070.0A0A346M107_CYNDA; Teosinte branched 1
STRINGPavir.Ia00838.1.p1e-157(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72533651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.13e-25TCP domain protein 12
Publications ? help Back to Top
  1. Tenaillon MI, et al.
    Patterns of DNA sequence polymorphism along chromosome 1 of maize (Zea mays ssp. mays L.).
    Proc. Natl. Acad. Sci. U.S.A., 2001. 98(16): p. 9161-6
    [PMID:11470895]
  2. Clark RM,Tavaré S,Doebley J
    Estimating a nucleotide substitution rate for maize from polymorphism at a major domestication locus.
    Mol. Biol. Evol., 2005. 22(11): p. 2304-12
    [PMID:16079248]