PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01753.1.g00030.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 445aa    MW: 46439.9 Da    PI: 8.2683
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01753.1.g00030.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-39107166261
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                     ++k l+cprC+s++tkfCy+nny++sqPr+fCk+C+ryWt+GGa+rnvPvG+grrknk++
  Zpz_sc01753.1.g00030.1.sm.mkhc 107 PDKVLPCPRCNSMDTKFCYFNNYNVSQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKNKNA 166
                                     78999****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30103164IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32108165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.994111165IPR003851Zinc finger, Dof-type
PROSITE patternPS013610113149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGECRGGGGG GGGGGAGDCL IKLFGKTIPV PEAGDAKDLQ HSSGSSSSID SDANKENANQ  60
ETSDPPPQPE VVDAEDPKSS SSPPEPRQPS GGADDEASNH KEKLKKPDKV LPCPRCNSMD  120
TKFCYFNNYN VSQPRHFCKN CQRYWTAGGA MRNVPVGAGR RKNKNAVAAS HFLQRVRAAV  180
LVGGDPLKTN GTVLSFGAHG AAPALDLAEQ VVGHLKEKML MPVGNAGNHQ SVVDPCSDVS  240
STGDAKNLSD AKSNVTVPKP VNGVQHPANM NGGATMWPYS CAPPSQAYYP SGIAIPIYPA  300
APGYWGCMVP GGWSPLPWPL QPPTQGLSSP TSTAPSVSSG AGHSLTLGKH AREGDEGRSH  360
GSGKVWAPKT IRIGDADEVA KSSIWSLIGI KGDKQNTDTD GRKNGTVFEP KHEAKSAKQA  420
MITSSPLLHA NPVALTRSLT FQEGS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01753.1.g00030.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5823991e-100KC582399.1 Sorghum bicolor dof2 protein (dof2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983151.10.0cyclic dof factor 1
TrEMBLK4AA810.0K4AA81_SETIT; Uncharacterized protein
STRINGSi035787m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-62cycling DOF factor 2