PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01748.1.g00060.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 732aa    MW: 79325.4 Da    PI: 7.8511
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01748.1.g00060.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.23e-11365402241
                                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
                 Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 
                                     g W +eEd +l+ av++lG   W+++a++++ +R++++c 
  Zpz_sc01748.1.g00060.1.sm.mkhc 365 GEWQPEEDWKLLAAVAKLGQA-WSKVAKMIP-RRSDNMCM 402
                                     79*****************99.*********.*******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071735298360IPR001005SANT/Myb domain
CDDcd001670.00165329358No hitNo description
Gene3DG3DSA:1.10.10.601.7E-10332364IPR009057Homeodomain-like
PROSITE profilePS500906.202333358IPR017877Myb-like domain
SuperFamilySSF466891.68E-18339402IPR009057Homeodomain-like
PROSITE profilePS5129414.343359410IPR017930Myb domain
SMARTSM007171.6E-4363411IPR001005SANT/Myb domain
PfamPF002492.0E-10365402IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-14365402IPR009057Homeodomain-like
CDDcd001671.06E-6366403No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MDFYSDDSDP DLDAELQEDL DALRRSCILS GAAEPDAAVA QLSAAAAASS SSYLAGPSTP  60
AASASVTAPA AAHDSSDDDE EDEDLALVRS IRESLRLTRA SPPPDAGDGT TEPRQICVWP  120
PSDTDDDEEE DLETLRAIQR RFSHYQSGTS TSSPKDLKSK AFLEARGECI ATEPEKDITV  180
QKENVKAVLS RTGFPKAALL LVDALKKNRA CQKFIRRKMV NIEAKIEENK ELRDRVKCLM  240
NFQLSCRRAA GKFLCQKEDP RVRLISSRKP SAQVAKNKYK KMPSLFLGPA ENLHVSNGTG  300
DFGALDMAYA LTNAASSFEV PPESLRSVLP LINWDKIAAM YLPGRSGAEC ESRWCDVLNP  360
NLNHGEWQPE EDWKLLAAVA KLGQAWSKVA KMIPRRSDNM CMRGGSKKQV KEALPMSDGL  420
SSSSKGRTRS KKKYTPDNNV SVQKIGSIPE NNEAVPAELR GIVSTDTGAE ENRMAESDSL  480
GEEAVVKKRK RASKSDGNEK AVKKRMRGSI PVDNEAVPTE LRGIISTDIE IGTNKIMDPV  540
PVVEEGVLKK RTRRTSSVCN EGAVRRRSNT VGSGGVVRKR MKGSISVDSE AVSMELSDII  600
STDIDAGTDS MIDPVSTGEE VVAKKRGRCA NTIGNEAVVG KRRSSISVGE EGTMKRKRRG  660
SVSVESNGTA TRKKRASSKK PTEDCSIAEN IMTAIPGSDL PSNAILDRIN GSSSGAVTCT  720
CNCDEQRIRE AP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1656674KRRGSVSVESNGTATRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-26myb domain protein 4r1