PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01707.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 498aa    MW: 53833.8 Da    PI: 9.8496
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01707.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.26.7e-37222276559
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                    l+cprC s+ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+
  Zpz_sc01707.1.g00040.1.am.mk 222 PLPCPRCRSRNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNR 276
                                   679**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.4E-30223276IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733223277IPR003851Zinc finger, Dof-type
PROSITE patternPS013610225261IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-19232276IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MPQAGVRGCQ RRSGSRHARM TRPHPFAFPQ QQRNHTASRA KKRTSSAITH CYAQKLVVAR  60
GRREETTASR VSCPVAFIPR PNSPAFFRLL CAGSSVLQPP AAFLAWKVRM LSHVEMAPAA  120
GGFKLFGKVI TQCAAPAPPP GEPASRAAAF LRERADPDES DQPTVKREAC VDHDFEKQQQ  180
QQDQGVGGGG TESGESKAAH QSSRQQDTAE ARSAAAASSA PPLPCPRCRS RNTKFCYFNN  240
YNVNQPRHFC KDCHRYWTAG GALRNVPVGA GRRKNRPLGP VVAAVPGHHH QLQHHRAAAA  300
AGFVLGFPGN PTSPTSPVYA DRWPVCPDRR FAFAFGGIET GNLAEQLLLS THQCAAKGGR  360
GHCRKAPGGK PRALVVGCCT LGSLLDAGLQ DATDTEQAAR TVTWVGSAAC DFMSAAIMSG  420
NAAAAVLPLR TERERESWGQ WHGISSATTQ KDVRNYAVEN EDMWIGSHRS GRDMEAWITI  480
RCAQATAPDV DGWMSLFC
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01707.1.g00040.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269982e-82KJ726998.1 Zea mays clone pUT3970 C2C2-DOF transcription factor (DOF37) gene, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-27Dof family protein