PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01693.1.g00030.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 231aa    MW: 24198.3 Da    PI: 9.6824
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01693.1.g00030.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.51.3e-39461451100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C+++ yf   +p+kfa+vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il
  Zpz_sc01693.1.g00030.1.sm.mk  46 PCAACKLLRRRCAQECPFSLYFSPLEPHKFAAVHKVFGASNVSKMLLEVHESQRADAANSLVYEANLRLRDPVYGCMGAIL 126
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lqqq++ l+aela++++e
  Zpz_sc01693.1.g00030.1.sm.mk 127 TLQQQVQALEAELAAVRAE 145
                                   ***************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.82145146IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3946143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSTASHWQDH EVGRKIKRES AAAAADRMTA AAAAAGAGSA LNTITPCAAC KLLRRRCAQE  60
CPFSLYFSPL EPHKFAAVHK VFGASNVSKM LLEVHESQRA DAANSLVYEA NLRLRDPVYG  120
CMGAILTLQQ QVQALEAELA AVRAEIVRRR YRPAAAASAA GVATVLPSSH ASQLLAASAA  180
GRGLPAASAR SAATRTTTLA ASSSSSSTVY AAASNSTDYS SITNENVPYF R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-41301671127LOB family transfactor Ramosa2.1
5ly0_B9e-41301671127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01693.1.g00030.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-123FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167556.11e-114LOB domain-containing protein 15-like
SwissprotQ9AT611e-66LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A3B5ZSF71e-113A0A3B5ZSF7_WHEAT; Uncharacterized protein
TrEMBLA0A452Y3X41e-112A0A452Y3X4_AEGTS; Uncharacterized protein
STRINGTraes_1DS_BB8508CC6.11e-113(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-57LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]