PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01658.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 733aa    MW: 80368.2 Da    PI: 10.7267
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01658.1.g00060.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.69.5e-23297340144
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                   d+epgrCrRtDGKkWRCs+++++++k+CE+H hrg++rsrk++e
  Zpz_sc01658.1.g00060.1.am.mk 297 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHKHRGKNRSRKPVE 340
                                   79***************************************998 PP

2QLQ60.54.7e-21226261237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ ++++
  Zpz_sc01658.1.g00060.1.am.mk 226 PFTATQWQELEHQALIYKCLASGMPIPSHLVPPLRR 261
                                   9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-11225261IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.0E-15226259IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.663226261IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.744297341IPR014977WRC domain
PfamPF088792.1E-18298340IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MPADFKDGPK SQKMSRTPDN RRFKFWAGGG LHTVRVQALV GGCRPSAWCE YRRRTKRGSF  60
LGRPLPRPRS ALLRESSARR PDRVAAARSK AARASGRSAA RSKLPERAGA GRLRCASIAT  120
VERRPNGSDK LQAAALKSLR RRPHLELTRT RPRPTTKPAH LVTLAITLAA TPPLHRSTKK  180
PASRPRGAPG TYSCGAGSSC ATQVTAKMMM MTNREGGAGA AAGRYPFTAT QWQELEHQAL  240
IYKCLASGMP IPSHLVPPLR RILDSALATS PSLGFPPQPS LGWGCYGMAF GRKAHEDPEP  300
GRCRRTDGKK WRCSKEAYPD SKYCEKHKHR GKNRSRKPVE MSLATAAPSA SAASATTATS  360
SPAPSYHRPA PEAAPYTALY GGSPYAASTR PVTGAYHAAQ VSPFHIHLDT TYPHPPASSY  420
YSVDQRDYAY GHTAKDVGEH AFFSDGATER DRHAAGQWQF RQLGMEPKPS ATSLFPNGGC  480
NNGTASAYAV DMTTKDDDEE RRRQQQHCFV LGADLRLERP SNHDVPEAQK PLRPFFDEWP  540
HEKSNKGSWM GLGGETQLSM AIPVAANDLP VTSRYRTLLF QDLAAEPRPC SLESYWQQGF  600
KACTCCLPGT VTVSRSDGRK YRSERVNRGL KPGMVPDHLT PGAPPSDPRV AHRQSNDGAA  660
RAVEKKRLEY AKTIGTPAAL RKIWPLARER KWSRTGPPAL QPPRTVIEHG RGVAPSCLQY  720
YAKRTVLLNS DGR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01658.1.g00060.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702921e-135EU970292.1 Zea mays clone 343148 atGRF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954097.10.0growth-regulating factor 1 isoform X1
RefseqXP_012701613.10.0growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-158GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK3YTB60.0K3YTB6_SETIT; Uncharacterized protein
TrEMBLK3YTC00.0K3YTC0_SETIT; Uncharacterized protein
STRINGSi017515m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-46growth-regulating factor 5