PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01621.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 332aa    MW: 36166.9 Da    PI: 9.0263
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01621.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.44.7e-36116171661
                        zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                    +cprCds ntkfCyynnyslsqPryfCk+C ryWtkGG+lrnvPvGgg+rkn++ 
  Zpz_sc01621.1.g00090.1.am.mk 116 PSCPRCDSPNTKFCYYNNYSLSQPRYFCKGCCRYWTKGGSLRNVPVGGGCRKNRRG 171
                                   58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28103170IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.416116170IPR003851Zinc finger, Dof-type
PfamPF027013.2E-30117170IPR003851Zinc finger, Dof-type
PROSITE patternPS013610118154IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MRRPLSKRKA RNHERRVHQS SRRRAATLMG HASPPRSRVA FYRRTSHLAS SHRCPCIVIT  60
SLHRSDRSSP PINQATGPGQ MLSSRCDNML PLYAGGARRA VPLDHRRYRP NVEVAPSCPR  120
CDSPNTKFCY YNNYSLSQPR YFCKGCCRYW TKGGSLRNVP VGGGCRKNRR GKSARSTLAA  180
AAASGGAAAF SHRGTVRPDL ILEGMVGNQP VSDDKPAVAG GSAIDLALLY AKFLKPQPPP  240
GEQCPAEPES CPDARGEELS FSVDQSCYDS LGLPTDGGDL ILPSTWCHES KDELFDPLPE  300
DAMSLHDSIA GADDVWSNAF ACQGLEAALC RP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01621.1.g00090.1.am.mk
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0872622e-87BT087262.1 Zea mays full-length cDNA clone ZM_BFb0021J09 mRNA, complete cds.
GenBankJX4284772e-87JX428477.1 Zea mays subsp. mays clone pUT3073 DOF20 C2C2-DOF type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654467.11e-117PREDICTED: uncharacterized protein LOC102700144
TrEMBLA0A1D8F0J01e-117A0A1D8F0J0_9POAL; Dof protein
STRINGOB05G25870.11e-117(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.18e-36Dof family protein