PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01608.1.g00100.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 371aa    MW: 38448.3 Da    PI: 10.2176
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01608.1.g00100.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18.1e-38162220462
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +  +cprC+s++tkfCyynny+++qPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Zpz_sc01608.1.g00100.1.sm.mk 162 EGDPCPRCQSRDTKFCYYNNYNTAQPRHFCKGCRRYWTKGGTLRNVPVGGGTRKKPSSS 220
                                   5679**************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-25162214IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.202164218IPR003851Zinc finger, Dof-type
PfamPF027012.0E-31165216IPR003851Zinc finger, Dof-type
PROSITE patternPS013610166202IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGNSVTRAPP RRPRSCGLYW ALRDLWSTSR SDADAPRAPT ALLFAFVNRP FATPFRRFPA  60
PLSRERDART NRTDGSVAHA GGVRAGRPAA GAAVRGRGPA PAEGVRRASA AVGGRGGYPC  120
DGGGSGGGPX XXVDLRRPKG YAAPPPPSAA AGGTHVTAAA AEGDPCPRCQ SRDTKFCYYN  180
NYNTAQPRHF CKGCRRYWTK GGTLRNVPVG GGTRKKPSSS SSSSSPSSYA AAAKPKGPYK  240
KKRRVAPPEP SVPAPAPVAF PVVDSGKTTL TTTTAATADS AKTTTDAASE ITTELVVPAA  300
EDDALTQLLQ PVDTAVALGL GLSDFPSLGK SALHDIPDSF EWPAASFDLS ACWGTAGGFA  360
DSDPALFLNL P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239243KKKRR
2239244KKKRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01608.1.g00100.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9658593e-71EU965859.1 Zea mays clone 289437 dof zinc finger protein MNB1A mRNA, complete cds.
GenBankEU9693883e-71EU969388.1 Zea mays clone 329608 dof zinc finger protein MNB1A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973764.15e-73dof zinc finger protein MNB1A
SwissprotP385645e-66MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A0D9X9637e-74A0A0D9X963_9ORYZ; Uncharacterized protein
STRINGLPERR08G15690.11e-74(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-26DOF zinc finger protein 1
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]