PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01515.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 408aa    MW: 43120.8 Da    PI: 9.3084
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01515.1.g00060.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.82.2e-32111166359
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                   +v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+ev++
  Zpz_sc01515.1.g00060.1.am.mk 111 GVKYRECLKNHAAAMGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKEVDD 166
                                   699*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.8E-29112164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-30113164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-23113164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.893114163IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.56E-19260328IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-29261330IPR009057Homeodomain-like
TIGRFAMsTIGR015659.2E-28270326IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MQRRTDQASP AAAAAIFSLE RRRREEDEAR GGGSMDLSGA QGELPIPMHA PASPYASGGS  60
AGGRVLQQLH RERGNNKGNE ESPVRLPPSP PAASEDRGSG KKRAAGGGGS GVKYRECLKN  120
HAAAMGGNAT DGCGEFMPSG EEGSLEALKC SACGCHRNFH RKEVDDDDED LNADVCAGHG  180
HFAGRRLLAT AMPPHLKSGG AGGGLLVTAD PYGVGAYAAM RAVPPPPPLH HHHHQFVNAM  240
PLRSVHTSEE SDGMDGGAGA RGSSSSLLSK KRFRTKFTAE QKARMLDFAE RVGWRLQKLE  300
DGMVHAFCQE IGVKRRVLKV WMHNNKHSLA TKRLEAPPGM ASAPAPPPPM PMVPPPPPAL  360
PSSPQPGPSF HLGGPSSQPP QHMAMPMVPP PPPFHHRGPS SPAPLKLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-242693281675ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11924ERRRRE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01515.1.g00060.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9668551e-92EU966855.1 Zea mays clone 297761 mRNA sequence.
GenBankKJ7280451e-92KJ728045.1 Zea mays clone pUT6191 ZF-HD transcription factor (ZHD1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008678039.11e-112zinc-finger homeodomain protein 4 isoform X1
SwissprotQ53N871e-82ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLK7TRK31e-111K7TRK3_MAIZE; Putative homeobox DNA-binding domain superfamily protein
STRINGGRMZM2G068330_P021e-112(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.25e-55homeobox protein 31