PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01511.1.g00190.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 684aa    MW: 75149.2 Da    PI: 10.2928
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01511.1.g00190.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC771.9e-24402446145
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Zpz_sc01511.1.g00190.1.am.mk 402 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 446
                                   79****************************************997 PP

2QLQ57.25.1e-20318353237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FT+aQ+++L++Q+l+yKyL+a++ vPp+L+++i++
  Zpz_sc01511.1.g00190.1.am.mk 318 PFTPAQFEELEQQALIYKYLVAGVAVPPDLVVPIRR 353
                                   8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-11317353IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.4E-14318352IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.065318353IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486402446IPR014977WRC domain
PfamPF088798.3E-21403445IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MEIAVFRLTF QIESWISKRS WKNETRLVAN RLGLSSSQDR WHETSKKWPE EEEEDDADFP  60
RGPSVRGAST PSVQPWQRPS DGDIFFQRGP LGQSARAQEA SVFFLIPGRG GKGGNGNGAR  120
APSCWADASK RNGLVVSGSS TSHPPPTRAP RDGTTTQRRE NPRRKIKAVR ARERAGEARH  180
LTSQPRTAQG ATQARIQQQN SRGERIKEGE AGCGEHAARE RDRRDGDAVC LSFPGRRRRG  240
RRRPPLIHHH HHHYHRLAPP LLPRLPALRV SNGGSSRLRL CDLVVVSFAR FLVLTTWGSG  300
GGLGEDAQMS GRWARPLPFT PAQFEELEQQ ALIYKYLVAG VAVPPDLVVP IRRCLDSLAT  360
RFYGHPTRTV PVLLFYLLLL TTPSLPYGFW LAYGSYFGKK LDPEPGRCRR TDGKKWRCSK  420
EAAPDSKYCE RHMHRGRNRS RKPVETQLVP QSQPPSAMAP IAAQPLTAAT SGGNFQSHSL  480
YPAIAGSNGG GEGSNISSPF TSSLSSSQLN LDNTATYAAL GGGTGKDLRY TGYGIRSLAD  540
EHNQLISDAI DSSMVNQWRL PPSHNSSFPL PSYPQLGALS DLGQSAVNSL SKIDRQPLSF  600
LGNDFGTVGS VKQENQLRPF FDEWPKSRES WPGLGDENAN LASFSATQLS MSIPMVSSDF  660
SAATPASSQS PNGEQFSKEM ETLA
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269|PubMed:24532604, ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747, ECO:0000269|PubMed:27250749, ECO:0000305|PubMed:26187814, ECO:0000305|PubMed:27107174, ECO:0000305|PubMed:27250747, ECO:0000305|PubMed:27250749}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01511.1.g00190.1.am.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639832e-76AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025791920.10.0growth-regulating factor 4-like
SwissprotQ6ZIK51e-158GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A2T7FAX50.0A0A2T7FAX5_9POAL; Uncharacterized protein
STRINGPavir.Aa00789.1.p1e-176(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-41growth-regulating factor 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  3. Hu J, et al.
    A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice.
    Mol Plant, 2015. 8(10): p. 1455-65
    [PMID:26187814]
  4. Sun P, et al.
    OsGRF4 controls grain shape, panicle length and seed shattering in rice.
    J Integr Plant Biol, 2016. 58(10): p. 836-847
    [PMID:26936408]
  5. Li S, et al.
    The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice.
    Plant Biotechnol. J., 2016. 14(11): p. 2134-2146
    [PMID:27107174]
  6. Che R, et al.
    Control of grain size and rice yield by GL2-mediated brassinosteroid responses.
    Nat Plants, 2015. 2: p. 15195
    [PMID:27250747]
  7. Duan P, et al.
    Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice.
    Nat Plants, 2015. 2: p. 15203
    [PMID:27250749]