PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01511.1.g00100.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 246aa    MW: 27555.2 Da    PI: 8.6036
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01511.1.g00100.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.7e-302678153
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                                    kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++ gLtl+h+kSHLQ +
  Zpz_sc01511.1.g00100.1.sm.mkhc 26 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMRGLTLYHLKSHLQTW 78
                                    79*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-282380IPR009057Homeodomain-like
PROSITE profilePS5129411.5152383IPR017930Myb domain
TIGRFAMsTIGR015578.4E-222677IPR006447Myb domain, plants
SuperFamilySSF466894.12E-142683IPR009057Homeodomain-like
PfamPF002493.7E-92878IPR001005SANT/Myb domain
PfamPF143791.7E-10115140IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MFEGMERAGY GAAAAMGGVV LSRDPKPRLR WTPDLHERFV EAVTKLGGPD KATPKSVLRL  60
MGMRGLTLYH LKSHLQTWEA EQERYRLGSQ KRGTGHQFLR SGTSYHSICC QQQHGVQKKL  120
QMRIEAQGKY LQTILEKAQS NLSYDASGAE NLEATRSQLT DFNLALSGFM DNVTQVCEQN  180
SGELTKAMSQ DNLRTSNIGF QLYHGVQDVE DVKCTPDDGL LLLDLNIRGG YGHRPSSDLK  240
INQHMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-192686260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01511.1.g00100.1.sm.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3569261e-79AK356926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1042E14.
GenBankAK3660411e-79AK366041.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2039P18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808925.11e-124myb family transcription factor PHL11-like
TrEMBLA0A2S3GSU51e-123A0A2S3GSU5_9POAL; Uncharacterized protein
STRINGSi018049m1e-123(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-49G2-like family protein