PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01506.1.g00140.1.es.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 412aa    MW: 46421.1 Da    PI: 7.4232
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01506.1.g00140.1.es.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.9e-344397155
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    kprl+WtpeLH+rFv+av+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Zpz_sc01506.1.g00140.1.es.mkhc 43 KPRLKWTPELHQRFVHAVNQLGGADKATPKTVMRLMGIPGLTLYHLKSHLQKYRL 97
                                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.88640100IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-324198IPR009057Homeodomain-like
SuperFamilySSF466893.05E-174298IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-234398IPR006447Myb domain, plants
PfamPF002499.6E-104596IPR001005SANT/Myb domain
PfamPF143791.2E-20145191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MYPQHQGPSE LFTRTSFPME QQLFLRGGNS QGDSGLVLST DAKPRLKWTP ELHQRFVHAV  60
NQLGGADKAT PKTVMRLMGI PGLTLYHLKS HLQKYRLSKN LQAQANVGAT KNAIGCTPVT  120
DRIPGTSVPT MSSTSVIPQA EKTIPIGEAL QMQIEVQRQL NEQLEVQRHL QLQIKAQGKY  180
LQAVLEQAQE TLGQQNLGPA NLEDAKIKIS ELVSQVSNEC FSNATTDIKE NSNILRLEPQ  240
QIQFIESSTN TNLTEAEGFV KEHRLQNHGV LKAYDDRSLF CRKGSHENED RLTLNRSLSE  300
RRLAHLHNVK VYDKLEFVCG SEKEAPAEYI TPQKDSRGST ISSALGSKEG QAVKQSLEEQ  360
NYRKQAVEYQ RESKLLDFEN PYSGKKLDLN THNIDDNDQP YRHFDLNGFS WS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-204299158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01506.1.g00140.1.es.mkhc
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441286.20.0myb-related protein 2
RefseqXP_021303324.10.0myb-related protein 2
TrEMBLA0A1B6P9220.0A0A1B6P922_SORBI; Uncharacterized protein
STRINGPavir.J02359.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122793137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.37e-96G2-like family protein