PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01502.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 371aa    MW: 38820.7 Da    PI: 8.9597
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01502.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-31186238357
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                                   kv Y+eCl+NhAa+lGgh+vDGCgEfmps+g+    +alkCaACgCHR+FHR++ 
  Zpz_sc01502.1.g00110.1.am.mk 186 KVSYRECLRNHAAALGGHVVDGCGEFMPSPGTG--DDALKCAACGCHRSFHRKDD 238
                                   799**************************7776..89****************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-19187237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-26187237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.241189237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-26189237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.6E-9308341IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MFQRSAHHPQ KAIEQHGRLI GRVEPGCDGR WPGGRRKRTG ETTRRGWAEP DXXXXXXXXS  60
GAGLGLSVSG LGDGESAVED SGLGAGGWRL RVDGVVRVKV GLPRSLGLSS AETSRSHALG  120
RPVSGCQATH ALMEFTSSRR QEQVPIQEMG ASSTPPLAPA AVPRAPPTSS SGNGAGAAAS  180
AAPLPKVSYR ECLRNHAAAL GGHVVDGCGE FMPSPGTGDD ALKCAACGCH RSFHRKDDGQ  240
PRQLLLPAPA PAPPPPVTPT PPRVPLLMPP PHPSYPHYVP PPFSYHGTPS GSGGTTTESS  300
SEERGTPSAD AAAQPARRKR FRTKFTPEQK EQMLAFAERL GPLTVVGSLP NALIIEGQEA  360
CFAGFSLSPD S
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01502.1.g00110.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A3L6SWE33e-65A0A3L6SWE3_PANMI; Zinc-finger homeodomain protein 6-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.11e-20zinc finger homeodomain 1