PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01498.1.g00050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 1255aa    MW: 141095 Da    PI: 6.4425
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01498.1.g00050.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS275.91.2e-842335943364
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lLl+cAeav++++ + a +lL++++++as +gd+ qRla +f ++L+arl++++++l + +++++ s   ++e ++a++l
  Zpz_sc01498.1.g00050.1.am.mk 233 TLLLHCAEAVAANNRTVAGELLKQIKQNASATGDARQRLARCFSKGLEARLLGTGNQLWSLVAAERPS---VVELVKAYRL 310
                                   68*********************************************************999888888...9********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleet 161
                                      ++ + k++++   ++I++a+ g++rvH++D+++  G++W+ L++ +a +R++g p+l+iT+vg ++s   s++++ee 
  Zpz_sc01498.1.g00050.1.am.mk 311 SMAACCFSKVAFIFSIKTIMDAIVGKSRVHVVDYGMHCGFHWAELIRLMAkDRDGGRPELKITAVGCSQSLfwSAQMIEEQ 391
                                   **************************************************8899*************88889********* PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240
                                   g+rL+k A ++g++f+f+ ++a+++e++++++L++++gE+l+Vn +++ ++l+d+s+  ++  +rd vL  +++++P+ ++
  Zpz_sc01498.1.g00050.1.am.mk 392 GRRLSKCAGKFGLSFKFHSITATKWECVRIQDLNTDTGEVLIVNDMYNFMTLMDDSMFFDDrsPRDIVLGNIRGMRPDAFI 472
                                   ********************************************************97776669***************99 PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                    +  +++ n++sFl rf eal yy+alfd ++a++pr+se r ++E+ellg+++ nvvaceg++   r e++++ ++r ++
  Zpz_sc01498.1.g00050.1.am.mk 473 QSIVNSS-NGGSFLSRFREALFYYTALFDVFDATMPRQSESRLVLEQELLGNHLLNVVACEGRDLMGRPEKYRQCQARNQR 552
                                   8877654.899********************************************************************** PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                                   aG+k++pl+  ++k +k  ++++++d +++ e+ ++l++gW+ 
  Zpz_sc01498.1.g00050.1.am.mk 553 AGLKQLPLKPGIVKGIKEFVKTHHKD-FMLGEDGQWLLQGWMA 594
                                   ************************77.**************85 PP

2GRAS320.92.6e-9887912472373
                          GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80  
                                      lLl+cAe v ++ ++ a++lL++++ +asp+gd++qRla+yf+eAL++rl++++ + +      + + ++ ++ l+a
  Zpz_sc01498.1.g00050.1.am.mk  879 HALLLRCAETVMDDGHRGARELLEKIKRHASPTGDATQRLAHYFAEALETRLTGMGAHRS------SFTIQQPVRFLKA 951 
                                    579***************************************************544443......3333446799*** PP

                          GRAS   81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skee 157 
                                    + l+  ++ + k++++ +N+ I++a++g +r+Hi+D+++ +G+QWp Ll+ La+R++gpp++ iTg++  ++    ++ 
  Zpz_sc01498.1.g00050.1.am.mk  952 YPLYIATCCFNKVAFMFCNRSIYQAAAGRSRLHIVDYGVCHGFQWPVLLRWLAAREGGPPQVTITGIVLTKHWyrPSDH 1030
                                    *********************************************************************666699**** PP

                          GRAS  158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksl 234 
                                    +eetg+rL++ A+elgvpf+f++++a ++++++le+L+v+p+ alaVn+ ++l+ + d+sv ++   +rd vL  ++++
  Zpz_sc01498.1.g00050.1.am.mk 1031 IEETGHRLSNCARELGVPFKFQAIMAAKWDAVRLEDLNVDPDAALAVNSLFSLEMMDDDSVVVDRasPRDVVLGNIRRM 1109
                                    *********************************************************99987766669*********** PP

                          GRAS  235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313 
                                    +P v+++   +  + ++sFl+rf e+l +ysa+fd+l+a++pr se+r ++E  +lg  + n++aceg++r+ r e+++
  Zpz_sc01498.1.g00050.1.am.mk 1110 RPAVFTIGIVNGLC-GSSFLTRFRETLVHYSAMFDMLDATMPRGSEQRLVLESDMLGSFALNIIACEGQDRTDRFESYK 1187
                                    **********9988.779************************************************************* PP

                          GRAS  314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                                    +W++r+++a ++++pl+ ++   +  ++++ + + + ++e++ +l++gWk+r L++ S W
  Zpz_sc01498.1.g00050.1.am.mk 1188 QWHMRMQRAELRQLPLDRDIIGAVTDMVKQQYHKDFVIHEDRRWLLQGWKGRILFAHSTW 1247
                                    *****************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.428205585IPR005202Transcription factor GRAS
PfamPF035144.2E-82233594IPR005202Transcription factor GRAS
PROSITE profilePS5098554.4578521228IPR005202Transcription factor GRAS
PfamPF035149.0E-968791247IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1255 aa     Download sequence    Send to blast
MATTPEEFFV EGLVKPAPSS PSVFLDLPPT PDGNTDDPPS PGNILHLLWE DGIDDDLLYQ  60
CSDHHALLQA QQPFAQILSS PSSFVTNNDN RRGDTDTQGS KDPLQGGSGD LSSPFFKGAD  120
VVEAFLKGME EATRFLPGEN SIRSKAIKKR YSRDDYLEEE EEVRRTSKAT MMKIAEPEEV  180
DIVSEMMLRG DEACIEEMEK LRIAMDIEEG RKNKTRGKGV SKAAGDVVTD LPTLLLHCAE  240
AVAANNRTVA GELLKQIKQN ASATGDARQR LARCFSKGLE ARLLGTGNQL WSLVAAERPS  300
VVELVKAYRL SMAACCFSKV AFIFSIKTIM DAIVGKSRVH VVDYGMHCGF HWAELIRLMA  360
KDRDGGRPEL KITAVGCSQS LFWSAQMIEE QGRRLSKCAG KFGLSFKFHS ITATKWECVR  420
IQDLNTDTGE VLIVNDMYNF MTLMDDSMFF DDRSPRDIVL GNIRGMRPDA FIQSIVNSSN  480
GGSFLSRFRE ALFYYTALFD VFDATMPRQS ESRLVLEQEL LGNHLLNVVA CEGRDLMGRP  540
EKYRQCQARN QRAGLKQLPL KPGIVKGIKE FVKTHHKDFM LGEDGQWLLQ GWMASNGRLI  600
FEWILNRWAK EKLLNARNQV AAVTSSSTMA SAPKDQMGLD EPLPPSTSSI LLLPTFPLEQ  660
QQEQEHTPLE YISRMLMEEE EEDRVLLQYH DDHPVLIQAQ QSLAQVNSSS STSDNNASTT  720
NPSFSKALLN DERNSNLLFS SDGTILSRSA PSVVCSTDIE NATARAAAAE HDWRHAATMS  780
FLMGMAEASK FLPRHSNLVF KTINTHDTGA EVSRASKLMA MTETEEAFLL QTTIDKMMLN  840
DCKLSRGEME DLRAAMNNEA VARRQERRQR KRLLQVDLHA LLLRCAETVM DDGHRGAREL  900
LEKIKRHASP TGDATQRLAH YFAEALETRL TGMGAHRSSF TIQQPVRFLK AYPLYIATCC  960
FNKVAFMFCN RSIYQAAAGR SRLHIVDYGV CHGFQWPVLL RWLAAREGGP PQVTITGIVL  1020
TKHWYRPSDH IEETGHRLSN CARELGVPFK FQAIMAAKWD AVRLEDLNVD PDAALAVNSL  1080
FSLEMMDDDS VVVDRASPRD VVLGNIRRMR PAVFTIGIVN GLCGSSFLTR FRETLVHYSA  1140
MFDMLDATMP RGSEQRLVLE SDMLGSFALN IIACEGQDRT DRFESYKQWH MRMQRAELRQ  1200
LPLDRDIIGA VTDMVKQQYH KDFVIHEDRR WLLQGWKGRI LFAHSTWVAD DAYSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-3923512478374GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-105GRAS family protein