PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01414.1.g00110.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CAMTA
Protein Properties Length: 435aa    MW: 49247.3 Da    PI: 6.1657
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01414.1.g00110.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-155.41.2e-17529574117
                            CG-1  74 KvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                                     +vg+v++l+cyYah+e+np fqrrc+w+Le  +e+ivlv+y++v
  Zpz_sc01414.1.g00110.1.sm.mkhc  52 RVGNVDALSCYYAHGEQNPCFQRRCFWMLEPVYEHIVLVQYRDV 95 
                                     699***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143725.2161101IPR005559CG-1 DNA-binding domain
SMARTSM010762.7E-191096IPR005559CG-1 DNA-binding domain
PfamPF038596.4E-135295IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:1.25.40.209.5E-4126175IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500967.602236265IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MSESFDINVL REEARTRWLR PAEVYYILQN HERFPITPEP PKKPPSIAHI PRVGNVDALS  60
CYYAHGEQNP CFQRRCFWML EPVYEHIVLV QYRDVAESDS QFQQKLEYQP PGSLDSSDLR  120
IKLSAAKREK MVATILAAGA SATAVTDPTA QDPVGKTAAF LASERGHMGL AGYLSEVSLT  180
SHLASLTIEE SEISKGSAAV EAERAVESIS QRSAKRQGGT EDELSMKDSL AAVRNAAQAA  240
ARIQNAFRAF SFRKRQQKTA RLRDEYGMTQ EDIDELAAAA ASRSYHQNHA LNGQFYDKAA  300
AHVRGHQVRK KYKTFVSTVS VLEKVILRWR RRRQGLRGFR AEQPTMIVAE EEEEEDDDDV  360
DFEDDEATRM FRRQKVDEAL KEAVSRVLFM VESPEARMQY RRMLEEFRQA TAELGGSEVT  420
SLFNSELVGL DSFMH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975409.11e-129PREDICTED: calmodulin-binding transcription activator 4 isoform X3
RefseqXP_012703195.11e-129PREDICTED: calmodulin-binding transcription activator 4 isoform X4
TrEMBLA0A096SDH91e-169A0A096SDH9_MAIZE; Uncharacterized protein
STRINGMLOC_58709.11e-128(Hordeum vulgare)
STRINGSi009249m1e-127(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62383241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.14e-45Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains