PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01405.1.g00120.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 625aa    MW: 67288.1 Da    PI: 9.9125
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01405.1.g00120.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.16.9e-31286338558
                   ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   rY+eClkNhA+ +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Zpz_sc01405.1.g00120.1.am.mk 286 RYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 338
                                   8*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-26262339IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.5E-29286336IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-28286337IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.752287336IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.15E-12429490IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-23431490IPR009057Homeodomain-like
TIGRFAMsTIGR015652.8E-18441490IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MDHGLASPRC YKTACWVGTA VRMDLGVWTV TSTHVTNPVH SPHQQRSRTE SNALHLVDAA  60
HVWTTATTVR DGWRPPIRNR AHGGRNQSDR AGRMEGAQPA CRGEVACSLP CPHFRCLLFR  120
SAVGDRREAN TVNWTKRTAP LEALPAKIDG AVYSSVTSCV GAKPLEKSSG ERDSHAAKKA  180
MSATQRNAIS SPVEVSGGRE IGQERTERGL RGVASSRHKN AAMDFDDHDD GDEEMAPLPP  240
VLSSSYETPP QSAAFGGGVA PAAKPPSEPG SRAYKAPGGG GGGSGRYREC LKNHAVGIGG  300
HAVDGCGEFM AAGEEGTLDA LRCAACNCHR NFHRKESPTA EGSPISPAAI VAYGAMPHQQ  360
FSPYYRTPAG YFHHTPHHMA AAAAAAGHQP RPLALPSTSH SGRDDVDDLS GMAGPMSALG  420
PLSGMSLGAG PSGSGGSGSG KKRFRTKFTQ EQKDRMLAFS ERLGWRIQKH DEAAVQQFCD  480
EVGVKRHVLK RAKLLSLAAE GRRRRRCRGR ERQRCQLSMW KTGTERMEKQ ENTLSSQLPL  540
GPLLRAIARC HGVLAASAAL LIFHLAPLCF EYARHADAWL DDGGGLFMSG HRVWHAVAVV  600
RVCLLTAGRT RFRNVVLGFF LVKLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-204424901866ZF-HD homeobox family protein
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1503513RRRCRGRERQR
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01405.1.g00120.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-165CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-49homeobox protein 22