PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01398.1.g00040.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 446aa    MW: 49053.6 Da    PI: 8.7928
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01398.1.g00040.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.91.5e-30184238358
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   +vrY+eClkNhAa+ Gg+a+DGCgEfmp+ ge+g+ aal+C+ACgCHRnFHR+e++
  Zpz_sc01398.1.g00040.1.am.mk 184 EVRYRECLKNHAAAFGGTATDGCGEFMPA-GEDGSLAALRCSACGCHRNFHRKESS 238
                                   69**************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047706.6E-28185237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-28186236IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-20186237IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.225187236IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE patternPS000280223246IPR007087Zinc finger, C2H2
Gene3DG3DSA:1.10.10.601.1E-27299372IPR009057Homeodomain-like
SuperFamilySSF466891.17E-16302371IPR009057Homeodomain-like
TIGRFAMsTIGR015652.5E-25311367IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MDALSSSLDT TPRFVLFHFL QFLLPFFFFL LSIFLFLLNG ILLASLPLPF VPPLLEQWKE  60
ELIPFVRAGC WTGVAVLCGW SSKEVSKAGP CKSSRGGKGA KQASKASRMD FSRMQSELPM  120
AMHSGGSRYL GLHHHHAHEQ PQQQQHNHGA NGREMSPREV EEEAKNRQAL AVVPVATGAG  180
GGGEVRYREC LKNHAAAFGG TATDGCGEFM PAGEDGSLAA LRCSACGCHR NFHRKESSDG  240
HGRPLHRHQQ LTGDPLSPLH HRGLLVAAAP TRMVMPLSAA HPHPHHHATT SSESDDARQR  300
CDPHQQPAAT RKRFRTKFTV EQKARMLGFA EAAGWRLQRL EDAAVQRFCQ EVGVKRRVLK  360
VWMHNNKHTL ARRCHGDQDQ QQLHLPPAGD DGGGLPHLES GRSPAPQQQD QQQLHLPPAG  420
DDGGGLPHLE SGRSPAPQQQ VQLRLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-223103691675ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01398.1.g00040.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0432582e-82BT043258.1 Zea mays full-length cDNA clone ZM_BFc0135C02 mRNA, complete cds.
GenBankBT0650052e-82BT065005.1 Zea mays full-length cDNA clone ZM_BFc0120L10 mRNA, complete cds.
GenBankBT0655692e-82BT065569.1 Zea mays full-length cDNA clone ZM_BFb0298N18 mRNA, complete cds.
GenBankEU9655082e-82EU965508.1 Zea mays clone 286516 mRNA sequence.
GenBankJX4285002e-82JX428500.1 Zea mays subsp. mays clone pUT3098 ZHD21 ZF-HD type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443023.11e-107zinc-finger homeodomain protein 3
RefseqXP_021321592.11e-107zinc-finger homeodomain protein 3
SwissprotQ2QW441e-67ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLC5YTM11e-105C5YTM1_SORBI; Uncharacterized protein
STRINGSb08g006490.11e-106(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-60homeobox protein 31