PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01331.1.g00110.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 376aa    MW: 39397.1 Da    PI: 6.0508
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01331.1.g00110.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.81.1e-08190248563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   k+++r + NR +A rs +RK  +i eLe+kv+ ++ e +aL  +l  l+   a l +e+
  Zpz_sc01331.1.g00110.1.sm.mk 190 KKAKRIINNRQSAARSKERKTRYISELERKVQFMQREATALSTQLALLQRDTAGLSAEN 248
                                   89*******************************************99999888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-13186250IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691188251IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-10190245No hitNo description
SuperFamilySSF579594.22E-10190244No hitNo description
PfamPF001707.7E-8190246IPR004827Basic-leucine zipper domain
CDDcd147035.20E-22191242No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDQSPIAEGG NGRDAAGVGG GGNGLSLQPS PGAATPSSPT PRTECDMSRM PDSPMSKPGH  60
RRSLSDMIGL PDDLDLGAPG DGPSLSSDEN EEELFSMFIN VDKLNSPGGA SESESSCAVT  120
GGGGEGTPMS AAPGAGVKPR HQHSHSMDAS SSIPAEQLFG TLAVEGMSSA EAKKAMSAAK  180
LAELALIDPK KAKRIINNRQ SAARSKERKT RYISELERKV QFMQREATAL STQLALLQRD  240
TAGLSAENSE LKIRLQNTEH QVHLQDALND ALKSELQRLK FATGQMGNGG GGMMSFGGPF  300
GGNQPMMFHA NQQAMPPPFL AMQQQLPNPG PLHPLQAQHL QQQQQAALGL NMRGPVAAAP  360
GSQVSWAEAW SESSSG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01331.1.g00110.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974066.11e-169transcription factor RF2a
SwissprotQ69IL44e-96RF2A_ORYSJ; Transcription factor RF2a
TrEMBLK3YMV41e-168K3YMV4_SETIT; Uncharacterized protein
STRINGSi015587m1e-169(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.53e-51bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]