PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01292.1.g00110.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 237aa    MW: 25569.4 Da    PI: 10.5429
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01292.1.g00110.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH22.42.2e-0777120247
                                     HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHH CS
                             HLH   2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekA 47 
                                     r +h++ E+rRR++iN++     + +P +  ++    sK +iL  A
  Zpz_sc01292.1.g00110.1.sm.mkhc  77 RSKHSATEQRRRSKINDRTTVFSQKMPFP--PSILIQSKGQILGDA 120
                                     899*************************6..27777******9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.6E-566120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.1E-772120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.03975127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.3E-577120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MAVAECAAQH IFELERSNAG HYVQLTNLYA STGMWNHVDG VRMTMRERGV SKATVRVDRK  60
GGSYSDGGTD QRPNTPRSKH SATEQRRRSK INDRTTVFSQ KMPFPPSILI QSKGQILGDA  120
LPDPFMRNGS SPEFKFTGKL DGNNNMVTLA ADSGAQDQAE TDHMANIILH SIANPSGQIN  180
LGKRAVKRAA GGVSSNSKEP TETQPSSNNR TSNQLTPLGG GAEAPTHATK RHKSGNS
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01292.1.g00110.1.sm.mkhc
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699577.12e-63pentatricopeptide repeat-containing protein At3g12770
TrEMBLA0A1E5V2392e-63A0A1E5V239_9POAL; Pentatricopeptide repeat-containing protein
STRINGOPUNC09G12310.21e-52(Oryza punctata)
STRINGOBART09G13850.21e-52(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7291622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08130.17e-10bHLH family protein