PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01292.1.g00090.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 227aa    MW: 24167.9 Da    PI: 9.2755
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01292.1.g00090.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.2e-3848105562
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                     +cprC+s++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Zpz_sc01292.1.g00090.1.sm.mk  48 GDPCPRCESRDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSSSSS 105
                                   578**************************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-254899IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70549103IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3250103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MQEPGRRRAV PFVGVDLRRP KGYPPPAAKV EEEQARVKVN AEAPATAGDP CPRCESRDTK  60
FCYYNNYNTS QPRHFCKSCR RYWTKGGSLR NVPVGGGTRK SSSSSKSSPA APRNPKRSKN  120
SRNRRVAPAP DPAHGTDDTS IAGEVNSETK PAPLTEAAGS IAPAVEDSFK SSMSVALGLG  180
VTDVGGGGKE LPDPGQFEWP SSCGDLGSFW GTGVFADTDP SLFLNLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112124RNPKRSKNSRNRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence at the MNF1-binding site.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01292.1.g00090.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057593e-67AP005759.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0556A05.
GenBankAP0149653e-67AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126173e-67CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankKC9967333e-67KC996733.1 Oryza sativa transcription factor Dof25 (Dof25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957110.14e-80dof zinc finger protein MNB1A
SwissprotP385644e-55MNB1A_MAIZE; Dof zinc finger protein MNB1A
TrEMBLA0A1E5V2891e-92A0A1E5V289_9POAL; Dof zinc finger protein MNB1A
STRINGSi030774m1e-79(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.12e-30Dof family protein
Publications ? help Back to Top
  1. Yanagisawa S,Izui K
    Molecular cloning of two DNA-binding proteins of maize that are structurally different but interact with the same sequence motif.
    J. Biol. Chem., 1993. 268(21): p. 16028-36
    [PMID:8340424]