PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01275.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 380aa    MW: 40147.6 Da    PI: 11.6529
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01275.1.g00070.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.1e-38186242460
                        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   + l+cprCdst+tkfCyynny+l qPr+fCk+CrryWt+GGalrnvPvGgg+rk  +
  Zpz_sc01275.1.g00070.1.am.mk 186 AGLPCPRCDSTDTKFCYYNNYNLGQPRHFCKGCRRYWTRGGALRNVPVGGGTRKATA 242
                                   6789**************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.956188242IPR003851Zinc finger, Dof-type
PfamPF027016.4E-32188241IPR003851Zinc finger, Dof-type
PROSITE patternPS013610190226IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-21190236IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGGRRRRSHR LRSCGNVRDR RGERTLTFVL HVVNRTLPAS KRPMPETGGA MEKGIKMTLH  60
LKPRAKVFVS VSLWGGAALP LRAQRCFVYT LLSYTLPSKN RLLIATAAPR PRLVLSSSSS  120
LILHVRTRAT YFLGPACPPC RHPVLAVARS TAIQAGHQAA EGNALALVAA AAAAAGGGGG  180
GPKEPAGLPC PRCDSTDTKF CYYNNYNLGQ PRHFCKGCRR YWTRGGALRN VPVGGGTRKA  240
TAAAARRKRA SSSSASTASA TALLVSSSPV PRSVSAPAYA TTVLPYDLPS FMPALRTSPL  300
AAVEPDRRLL DLGGSFTSLL APAPDVRFST GFLVGGLPPV MPPPASSAPA LLLPPPHPPV  360
SQALAPEGFI WSMGWPDLSI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210GRRRRSHRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01275.1.g00070.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0619506e-57BT061950.2 Zea mays full-length cDNA clone ZM_BFb0200H06 mRNA, complete cds.
GenBankKJ7270136e-57KJ727013.1 Zea mays clone pUT3994 C2C2-DOF transcription factor (DOF7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001307837.11e-57uncharacterized protein LOC107325937
RefseqXP_002457194.24e-57dof zinc finger protein DOF3.4
TrEMBLA0A1E5UJL36e-58A0A1E5UJL3_9POAL; Dof zinc finger protein DOF3.4
STRINGPavir.Ea00244.1.p2e-56(Panicum virgatum)
STRINGGRMZM2G378490_P015e-57(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-27DOF zinc finger protein 1