PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01270.1.g00100.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 198aa    MW: 22228.1 Da    PI: 4.909
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01270.1.g00100.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.51.4e-3571061100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   aCaaCk++rr+C+++C la+yfpa+qp+ f+n+h+lFG+sn+lk+l+++ +e+r+dam++++ eA+a+   P +G++ +il
  Zpz_sc01270.1.g00100.1.sm.mk   7 ACAACKYQRRRCTAECQLAEYFPADQPRLFRNAHRLFGVSNILKTLARVAPERRRDAMRTIIIEANAWETYPSRGCMHFIL 87 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq++++ ++ +l++++++
  Zpz_sc01270.1.g00100.1.sm.mk  88 TLQHHIRDVELQLQQANQS 106
                                   **********999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.0456107IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-357104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MASGASACAA CKYQRRRCTA ECQLAEYFPA DQPRLFRNAH RLFGVSNILK TLARVAPERR  60
RDAMRTIIIE ANAWETYPSR GCMHFILTLQ HHIRDVELQL QQANQSIEAY RDVLGTLPDD  120
DSLLLQAPQT WTPMQLAQDD MNMMDGAATA TAAAASVVPE PGVEHRGHQD HIEPDDVSCF  180
FVDNIEEEMP LPPPPESR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2141187123LOB family transfactor Ramosa2.1
5ly0_B5e-2141187123LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01270.1.g00100.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813245.14e-38protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A1E5UTR91e-38A0A1E5UTR9_9POAL; Uncharacterized protein
STRINGPavir.J35697.1.p8e-36(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154591316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-30LOB domain-containing protein 27