PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01258.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 322aa    MW: 34391.6 Da    PI: 10.6563
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01258.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.91.4e-15269313347
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                                   + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Lea N+ L  
  Zpz_sc01258.1.g00010.1.am.mk 269 AMQRQKRMIKNRESAARSRERKQAYIAELESIVTQLEADNDVLLR 313
                                   679*************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-6267322IPR004827Basic-leucine zipper domain
PfamPF001701.1E-13269313IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117269314IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-11271315No hitNo description
CDDcd147072.14E-18271322No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-14272314No hitNo description
PROSITE patternPS000360274289IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MLSLSHLVRG GSWTGQLLLL APDERRESPT LSGRQVIAAR AQRKKVSKAR RADASSGRPG  60
FPVPAVHGAR QPDTRTIGCK PQGTATGQRE EDAGDLSSYL FATFSYATPV TRKRSEENNP  120
AGWRGRCVQR GAPNPRRSQV GNHATNLAAP HSPEDSTSRV ERLGSARHDS SPPPPHDITG  180
RGGSAGAAVP AASAPVVVAG GGAGTTTEMT LEDFLAREGA VKEDEVGILG PSAPVEGQVA  240
MGFFSGLETV TGSGRGRKRQ LMDPVDRAAM QRQKRMIKNR ESAARSRERK QAYIAELESI  300
VTQLEADNDV LLREQVLFLS AF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01258.1.g00010.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.17e-23G-box binding factor 4