PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01224.1.g00090.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 237aa    MW: 26297.3 Da    PI: 7.4235
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01224.1.g00090.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.7e-4075134261
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                   ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+++s
  Zpz_sc01224.1.g00090.1.sm.mk  75 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSRNS 134
                                   7899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3161132IPR003851Zinc finger, Dof-type
PfamPF027013.3E-3277133IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.82679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MKVDMRHEKE VEEMEGKASQ GLENVGLDES ATLDHKKQDK EQINNAEDKA APELNGDNGK  60
TANDESGQEK TVKKPDKILP CPRCNSMDTK FCYYNNYNVN QPRHFCKNCQ RYWTAGGTMR  120
NVPVGAGRRK SRNSSLHYRQ LLMAPDCLMG SRVDISRSLH PEALASSSST QTLRIDDPDE  180
AAKSSIWTTL GIKPGDPGTF KPFQSKVESK SQETDAAPVL QANLAALSRS QSFQESS
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01224.1.g00090.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565622.26e-82cyclic dof factor 2
RefseqXP_025815271.12e-81cyclic dof factor 2-like
TrEMBLA0A1D8RJ042e-95A0A1D8RJ04_ELECO; DNA-binding with one finger protein 15
STRINGBRADI2G09720.13e-81(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.14e-45cycling DOF factor 3