PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01220.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 323aa    MW: 34437.4 Da    PI: 4.7181
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01220.1.g00070.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-383389662
                        zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                   +cprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk+++s+
  Zpz_sc01220.1.g00070.1.am.mk 33 PNCPRCDSSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRSK 89
                                  68***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-301677IPR003851Zinc finger, Dof-type
PfamPF027012.7E-323387IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8913387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MLSSHHEAMM PYAPLPPSLL VDRRYKQGAE VAPNCPRCDS SNTKFCYYNN YSLSQPRYFC  60
KGCRRYWTKG GSLRNVPVGG GCRKSRRSKS SVRSTAVSIS GGRDAAFGNQ FPGPFRPDLV  120
LEGMVSNPAN PGQAMPDVPS SGDGSSIDLA MLYAKFLNNP PADASVGAVT PESAGKMDEA  180
FDSFSVSSDL SPSVLAPGAQ LDPCHDGFGE WSGPVSSSDP HSTTSTTATT TMLCADVSVQ  240
AALGELNFAM DQSCFDSIGL PADVDNLSSW CSIVPSLSTL EDTKYDSLVS FPDDALSLHQ  300
GMMNGPHHDW SVDCQGLEAL YMP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01220.1.g00070.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022682290.10.0uncharacterized protein LOC101752604
TrEMBLA0A2T7DDY70.0A0A2T7DDY7_9POAL; Uncharacterized protein
STRINGSi002230m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-30Dof family protein