PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01170.1.g00140.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 466aa    MW: 47463.7 Da    PI: 9.1569
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01170.1.g00140.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-3958118262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ s
  Zpz_sc01170.1.g00140.1.am.mk  58 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRPS 118
                                   7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3056116IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3360116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05962116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEDMLMATNA AAANPSQGSA ANPPAPAPSS TPGSALRGGA PAAVAGAGSA ERRVRPQKEK  60
ALNCPRCNST NTKFCYYNNY SLQQPRYFCK TCRRYWTEGG SLRNVPVGGG SRKNKRPSSS  120
SASDSTSASV TSSSMASSAG VASKNPKLTQ DGAQDLNLAF PHHGGLKAPV DFAAFPSLES  180
SSVGGATTSN GRGGSSGSAV GAISAMELLR STGYYMPLQV PMQMPGDYAA AGFSFGEFRA  240
PPPPPPPSQN VFGFSLDAHG SAAGAAAAGY GSGTGLPGAP ENASRLLFPF EDLKPPVSSG  300
GGDGAGGASV GTGDENSGHH QFEHGKEQGG GGPGAGHDTP EAGVAACQRT LGSLGLGAVA  360
RVADLRGALV LLAASPALGP VRSILGLAVR PPVAARSRAV PWVTRSCREG HGRVARQLRR  420
LHEGRAARRA CSFDCDQSNN DYTAHLAAVC QCKHDRCYAD QRAPGD
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01170.1.g00140.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001356786.11e-121dof zinc finger protein
RefseqXP_020403354.11e-121dof zinc finger protein isoform X1
SwissprotQ9SXG81e-107DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLA0A0A9GUS71e-146A0A0A9GUS7_ARUDO; Uncharacterized protein
STRINGSi010443m1e-120(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.15e-38Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]