PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01146.1.g00220.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 360aa    MW: 37700.9 Da    PI: 10.1318
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01146.1.g00220.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222e-38107167262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e  lkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+++
  Zpz_sc01146.1.g00220.1.am.mk 107 PEPGLKCPRCESTNTKFCYFNNYSLKQPRHFCKTCRRYWTRGGTLRNVPVGGGCRRNKRTK 167
                                   56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3791165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273111165IPR003851Zinc finger, Dof-type
PfamPF027013.5E-32111165IPR003851Zinc finger, Dof-type
PROSITE patternPS013610113149IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWNQRQQ QEQQQAHHGQ LQSGGGGGGG GGGVEPHRHQ QHQLPPVPPP  60
GALIAPRPDM AMVGAASGGG GGPTSGGSAV RPGSMTERAR LERIPQPEPG LKCPRCESTN  120
TKFCYFNNYS LKQPRHFCKT CRRYWTRGGT LRNVPVGGGC RRNKRTKSSK SNSSSAASAS  180
ATGGTSSSTS STATGGSSAA ATAGIMPPQT QLPFLASSLY QFGGDHYSAG ASRLGFSGLS  240
SLDPVDYQLG TGGGAGTAIG LDHWSMPQIQ QFPFFSRPDG VPPPMPGIYP FDAEGGGDAA  300
SFAGQMLPGS SGLITQLASV KMEDNNPQQR AIYSSACNPR SELARAGRRR REWLASQRSP
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01146.1.g00220.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824011e-116KC582401.1 Sorghum bicolor dof4 protein (dof4) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792577.11e-127dof zinc finger protein DOF2.4-like
TrEMBLA0A3L6SDN71e-132A0A3L6SDN7_PANMI; Dof zinc finger protein DOF2.4-like
STRINGPavir.J14743.1.p1e-123(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.23e-42OBF-binding protein 3