PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 254aa    MW: 27915.1 Da    PI: 5.4131
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                                    +e+ErrR ++++    +L +llPk    +   l+    + +A  YIk L  89 RKEIERRRTQEMRRLCVKLASLLPKEHYSSRDTLTQLGSVDEAAAYIKRL 138
                                   589**********************54455555***************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.29984138IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.6E-589138IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:, basic helix-loop-helix (bHLH) domain
SMARTSM003530.002690144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.22E-790153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457514.24e-66transcription factor bHLH162
TrEMBLA0A1B6Q2F71e-64A0A1B6Q2F7_SORBI; Uncharacterized protein
STRINGSb03g008570.12e-67(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.11e-15bHLH family protein