PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01128.1.g00300.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 436aa    MW: 47895.6 Da    PI: 9.9772
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01128.1.g00300.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-33126180155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Zpz_sc01128.1.g00300.1.am.mk 126 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 180
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-32123181IPR009057Homeodomain-like
PROSITE profilePS5129412.347123183IPR017930Myb domain
SuperFamilySSF466892.15E-16125181IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23126181IPR006447Myb domain, plants
PfamPF002491.5E-7128178IPR001005SANT/Myb domain
PfamPF143798.8E-25221267IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MAISRSPTRQ PTPSMAGPLA RNFCKTYLQA TPGTTQHKAA RTLFLVLESL VPNPAHQCST  60
RREERELIRE RSRGEGGGAA ARARGRGENR MFPSKKATSA AAAVSSNDRQ MCVQGDSGLV  120
LTTDPKPRLR WTVELHERFV DAVTQLGGPD KATPKTIMRV MGVKGLTLYH LKSHLQKFRL  180
GKQPHKEFND HSVKDAAAME MQRNVASSSG MMGRSMNDRN HVNEAIRMQV EVQRRLHEQL  240
EVQKHLQMRI EAQGKYMQSI LEKAYQTLAA GDVMSCPAGY KSLGNQAVLD VCSLKDIGPS  300
MGFPSLQDLH MYGGGHLDLQ QQMDRSMESF FACSDSSIGS LGKKRPNPYA AGKSPMMWGD  360
DEQGKSDHLQ MAPPMIDGGI DVMDSISDVY GDVKPMMSGD STGSKGFDGK LERPSPRRRM  420
GSPSVLGGQT RNLSYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-18126182157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-18126182157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-18126182157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-18126182157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01128.1.g00300.1.am.mk
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799290.10.0myb family transcription factor APL
SwissprotQ9SAK51e-103APL_ARATH; Myb family transcription factor APL
TrEMBLA0A1E5VH390.0A0A1E5VH39_9POAL; Myb family transcription factor APL
STRINGPavir.Aa03369.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.27e-99G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]