PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01089.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 372aa    MW: 40026 Da    PI: 10.228
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01089.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.62e-30304360259
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                   + v+Y+eC++NhAas+GghavDGC+Efm+  g++gta+al CaAC CHR+FHRreve 
  Zpz_sc01089.1.g00020.1.am.mk 304 KVVHYRECQRNHAASIGGHAVDGCREFMAL-GADGTADALVCAACSCHRSFHRREVEA 360
                                   5799*************************9.999*********************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027046.8E-106598IPR003854Gibberellin regulated protein
ProDomPD1257742.0E-17302356IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.8E-28306358IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.1E-25307358IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.696308357IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MAKLLALLLF CSLFLAAAAV MASAAEVIVI SGPSLPLFIA PSPGVEEGND DLHRRRSIAP  60
STGNHECHRR CSKTHHRKPC LFFCNKCCTK CLCVPPGSPL AAAGRLDANQ KSKRSLGKMA  120
DTPGRLVPSL RAPPVTVLRI DRLSLRAFME RSGAGKRTEK SRTARTPTKF AVLQPGTTLA  180
GKKLLDAFNR TPHPEGAGQA SQFIIMQNHT NNWWGTCASS NGTVFDFGVR ILQNRKHHSL  240
NQVVRHPRTP FSSSFLPVSP HQLPFLLVLE APQSPPPTTT TTATMGPKQD PPTANGTATR  300
KETKVVHYRE CQRNHAASIG GHAVDGCREF MALGADGTAD ALVCAACSCH RSFHRREVEA  360
AECSSTTTAA SG
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01089.1.g00020.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-23mini zinc finger 1