PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01055.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 272aa    MW: 29088.7 Da    PI: 6.9855
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01055.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34e-4171061100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vh++FGasnv+k+l++lp+++r da++sl+yeAear++dPvyG+v+ i+
  Zpz_sc01055.1.g00110.1.am.mk   7 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFSCVHRVFGASNVTKILNDLPQHQRGDAVASLAYEAEARIHDPVYGCVSYIT 87 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                   +lq + +q ++e+a++++e
  Zpz_sc01055.1.g00110.1.am.mk  88 ALQVRFNQIREEIAVARKE 106
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5296107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-407104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DNPAKFSCVH RVFGASNVTK ILNDLPQHQR  60
GDAVASLAYE AEARIHDPVY GCVSYITALQ VRFNQIREEI AVARKELARY IGPAAFVPLV  120
AAAPQYHHQQ YAGGVHLGVA HGHPHHPQQM VQLQHQHQQM AEAQQMAAAV EVAREQGVMM  180
RQAATYAHAL QGSDAGAAVA IVPHDAGAPY DGTFLLQQQQ PAPHAQTAVA LTYQMGSSPP  240
PSSPGQSPPE EVSHQQHMDG SDESSGGVAQ PA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4641108114LOB family transfactor Ramosa2.1
5ly0_B2e-4641108114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01055.1.g00110.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-100LOB domain-containing protein 6
TrEMBLA0A1E5VYJ41e-103A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m1e-100(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-51ASYMMETRIC LEAVES 2-like 1