PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01052.1.g00020.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family B3
Protein Properties Length: 125aa    MW: 14735.4 Da    PI: 10.3697
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01052.1.g00020.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.71.6e-16381201397
                                   TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                            B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                                   +++  l  ++a++ g++ +++ ++++ +   + W+ ++ +  +sgr +l++GW +Fv++ngL++gD+++F+l+++++ ++v
  Zpz_sc01052.1.g00020.1.sm.mk  38 NHLKELGSRYARTVGLPARRG-QVVVLQYMRKIWKTEM-MIHHSGRQFLGGGWLRFVHDNGLRVGDICLFELKNERKVTMV 116
                                   556667788999999997776.88888999********.677888889************************999999999 PP

                                   EEEE CS
                            B3  94 vkvf 97 
                                   v+++
  Zpz_sc01052.1.g00020.1.sm.mk 117 VHII 120
                                   9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-1622120IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-531123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.4E-1632120IPR015300DNA-binding pseudobarrel domain
PfamPF023621.7E-1438120IPR003340B3 DNA binding domain
CDDcd100176.04E-1445120No hitNo description
PROSITE profilePS5086311.22359123IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MKSCKCCERD LNHLDAKNQN MTCFLRLMTG NIKCNTENHL KELGSRYART VGLPARRGQV  60
VVLQYMRKIW KTEMMIHHSG RQFLGGGWLR FVHDNGLRVG DICLFELKNE RKVTMVVHII  120
WREKF
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01052.1.g00020.1.sm.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797617.11e-25B3 domain-containing protein Os03g0619800-like isoform X1
RefseqXP_025797619.11e-25B3 domain-containing protein Os03g0619800-like isoform X2
RefseqXP_025797620.11e-25B3 domain-containing protein Os03g0619800-like isoform X3
SwissprotQ6AV228e-19Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLA0A0A9SJW43e-33A0A0A9SJW4_ARUDO; Uncharacterized protein
STRINGPavir.Ib02115.1.p3e-29(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.13e-11B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]