PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01008.1.g00120.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 118aa    MW: 12741.5 Da    PI: 11.1114
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01008.1.g00120.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind76.35.5e-242685261
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                                  Fl+k+++++e+++++e+isw e+g+sfvv+++ efa+++Lp +Fkh nf+SFvRQLn+Y 
  Zpz_sc01008.1.g00120.1.am.mk 26 FLTKTHQMVEERATDEVISWAEQGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYV 85
                                  9**********************************************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004157.2E-2522113IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.35E-212288IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.103.4E-262291IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.5E-202685IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-132649IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-136476IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-137789IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MAGATAAGRP KGSGGRGGGG GGPAPFLTKT HQMVEERATD EVISWAEQGR SFVVWKPVEF  60
ARDLLPLHFK HCNFSSFVRQ LNTYVPFVVT KRNIAAQASC VGQQRKTKII ARAGRGDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A1e-151984165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A1e-151984165HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11321GGRGGGGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapZpz_sc01008.1.g00120.1.am.mk
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9665173e-90EU966517.1 Zea mays clone 294971 heat shock factor protein 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150318.12e-41uncharacterized protein LOC100283948
SwissprotQ67TP91e-36HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLB6TNF24e-40B6TNF2_MAIZE; Heat shock factor protein 4
STRINGGRMZM2G139535_P021e-42(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62020.11e-26heat shock transcription factor B2A
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Grand X, et al.
    Identification of positive and negative regulators of disease resistance to rice blast fungus using constitutive gene expression patterns.
    Plant Biotechnol. J., 2012. 10(7): p. 840-50
    [PMID:22607456]